SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT2G41450.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G41450.1
Domain Number 1 Region: 413-496
Classification Level Classification E-value
Superfamily BRCT domain 4.06e-16
Family BRCT domain 0.012
Further Details:      
 
Domain Number 2 Region: 76-211
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000551
Family N-acetyl transferase, NAT 0.0055
Further Details:      
 
Domain Number 3 Region: 520-601
Classification Level Classification E-value
Superfamily BRCT domain 0.0000707
Family BRCT domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT2G41450.1
Sequence length 612
Sequence
MAPKRASPMQSSLYSIGDYEVAVDGKNFTCESGPKSIQIKFPRNYRVKISEKDKIVSDYP
KEDMFLLLNPRDEDDFTKSHLQEVLKLYSKELPDMRYASNTGKQSAFLERCVSKGKYCSL
VLKSTLGGDSDEILAAITYQIVPADTQYAEIPLAAVTYTHQKKGFGKLVYEELMKRLHSV
GIRTIYCWADKESEGFWLKQGFIKLAEVDHKGKAKGLHIKSNIRKALCFPGGSTLMLSHL
NKEFISNLEISSSWKYQCEGSPLSARNNSTGPVTGDSVKLRESFGESVYLDCISGIRSPM
DSITGKENNNVISDQATTADSETKCSTPGLKRSWEASLSSLQSKRIRANNNNNSEIAKTD
LAQSSAKQSKDGNSSQVDITKDSLPTICKRNDVEQCRMATGIDMEARPNGQHYRILLMDI
CDENKRAWLTEVIRKLGGTVTLDGTTSTHIVTGKVRKTLNLCTALCSGAWIVSPSWLKES
VREGRFANEASHILHDEDYQLKYDTDLKSTVLRAKARPNSLLKGYDICVGPNIELPIKTS
SAIIKSAGGNVISGVNKVKEASKAIYIGCEEDTVGALFAAKKGIWTFSSEWFMNCVMKQQ
LDLQVPQFVESL
Download sequence
Identical sequences A0A178VS74 B3H6L5
NP_181676.2.80155 AT2G41450.1 AT2G41450.1 3702.AT2G41450.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]