SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT2G43110.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT2G43110.1
Domain Number - Region: 151-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00319
Family Tandem AAA-ATPase domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G43110.1
Sequence length 288
Sequence
MATTELKPSAVKNPKRNRRPSHGPKKDLKKKKTKITKKTKKSKAPTFDKTIEKSRSNDQK
TDNDEDEQLYSEPVSASEQLNYFLNHLDSAIGIKVSSLELEPIKDTCIVELSQGLDQDVS
NLGEHIKLSCGSSWRETLCEGESLERKVEPGNPSVLVISSSALRSLELLRGLHSLTKQCP
AVKLFSKHLKVEEQVSLLKKRVNIGSGTPNRIKKLVDIEALGLSRLDMIVIDMHPDVKGF
SLFTLPQVRDEFWDLYKNCFHQRVLEGRLRICMYGPKPSPNLKKKNKK
Download sequence
Identical sequences A0A178VR37 Q8GWB4
NP_850384.1.80155 3702.AT2G43110.1-P AT2G43110.1 AT2G43110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]