SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT2G44175.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G44175.1
Domain Number 1 Region: 38-100
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000000459
Family N-myristoyl transferase, NMT 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G44175.1
Sequence length 115
Sequence
MKPSDVNAYDRAEDGESSKIQSQKEKTDQIVKAKAHKDVGNTSLPESPVEPANPLSEIKQ
EPEKLPCGYEWITCDLNTDDMCSEVCKFLKEQYLVDGQKFKDALQQLALDDTFEV
Download sequence
Identical sequences Q3EBG4
GO.12370 AT2G44175.1 3702.AT2G44175.1-P AT2G44175.1 NP_850413.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]