SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT3G22560.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G22560.1
Domain Number 1 Region: 1-169
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.13e-39
Family N-acetyl transferase, NAT 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G22560.1
Sequence length 175
Sequence
MIMESPRIFLRPFNLSDAEDVFKWAGDDDVTRYLRWDSVNSLEEAKQHILNKAIPHPWRR
SISLLQDGHSIGYVSVKPDSGDGRCRADLAYAVAKEFWGRGIATAAVRMAVEQALEDFPE
VVRLQAVVEVENKASQRVLEKAGFRKEGLLEKYGFSKGVIRDMFLYSYVKDDCFV
Download sequence
Identical sequences Q9LJ90
AT3G22560.1 3702.AT3G22560.1-P NP_188895.1.80155 AT3G22560.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]