SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT3G46580.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G46580.1
Domain Number 1 Region: 27-80
Classification Level Classification E-value
Superfamily DNA-binding domain 3.6e-17
Family Methyl-CpG-binding domain, MBD 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G46580.1
Sequence length 182
Sequence
MSNGTDQAQPPPENPATPVDSKSRKRATPGDDNWLPPDWRTEIRVRTSGTKAGTVDKFYY
EPITGRKFRSKNEVLYYLEHGTPKKKSVKTAENGDSHSEHSEGRGSARRQTKSNKKVTEP
PPKPLNFDFLNVPEKVTWTGINGSEEAWLPFIGDYKIQESVSQDWDRVFTLVTSQNAGKT
MF
Download sequence
Identical sequences Q9SNC0
AT3G46580.1 NP_190242.1.80155 AT3G46580.1 3702.AT3G46580.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]