SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT3G57940.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT3G57940.1
Domain Number - Region: 217-322,369-402
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000443
Family Tandem AAA-ATPase domain 0.05
Further Details:      
 
Domain Number - Region: 606-640
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.012
Family N-acetyl transferase, NAT 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G57940.1
Sequence length 1028
Sequence
MRKKVDERIRTLIENGVKLRHRSMFVIIGDKSRDQIVNLHHMLSKAVIKCNPSVLWCYKD
KLDISSHKQKRSKQLKRLRERGQLDPEKLDAFSRLLDVGRVTHCLYKDSERILGNTFGMC
ILQDFEALTPNLLARTIETVEGGGLVVLILRSLTSLTSLCTMVMDVHDRFRTESHSEAAG
RFNERFLLSLASCKACVVMDDELNILPLSSHIRSITQVPTEKDSEGLSEAERDLKSLKED
LSDDFPVGPLIKKCCTLDQGKAVVTFFDAILDKALRSIVALIASRGRGKSAALGLAVAGA
VAAGYSNIYITAPSPDNLKTFFEFVCKGFDALEYKEHLDYDVVKSANPDFKKAVVRINIF
KQHRQTIQYIQPHEHEKLSQVELLVIDEAAAIPLPVVKSLLGPYLVFLSSTVSGYEGTGR
SLSLKLLQQLDEQSRAPATGLEGSGCLFKKIELTESIRYGSGDPIESWLNGLLCLDVATC
LPNPACHPSPSQCDLYYVNRDTLFSYHKDSELFLQRMMALCVSSHYKNSPNDLQLLADAP
AHHLFVLLGPVDESQNKIPDILCVIQVCLEGKISENSALQSLRDGHSPYGDQIPWKFCEQ
FRDTEFPGFSGARIVRIAVHPNAMKMGYGSAAVELLTRYFEGQIAPISEAEDKVDVEHAP
IKVTEAAEKVSMLEEQVKPRTNLPPLLVPLHDRRPEKLHYIGVSFGLTLDLFRFWRKHNF
APFYVSQIPSAVTGEHTCMLLKPLKNDELEVNESDELGFFTPFYKDFKIRFSKLLSDKFK
KMDYKLAMSVLNPKINFAEVDSSGSSSGGFLKTLNGILSPYDMERLRAYTENLTDFNLVY
DICKTLAHQYFEEKLPVSLSYVQASILLCLGLQETDFSSIERQMQLERGQIHSLLLKVAR
ELYKYLNGVAGKEIKSALPRLKERELTAHNVSVDDDIREGAKQVEEQMKKEKIEGLMDSE
LQQYVIGDKEAEALQHSKISSSGIISVKSTKSENENGFDKSTKKRSSDKRSSSSSKSKSS
KKRKSLKE
Download sequence
Identical sequences Q9M2Q4
3702.AT3G57940.1-P AT3G57940.1 NP_191353.2.80155 AT3G57940.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]