SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT4G00955.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT4G00955.1
Domain Number - Region: 206-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family EGF-like domain of nidogen-1 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G00955.1
Sequence length 252
Sequence
MVMISYKLNLVLIIILIGGSFNDLRVSSAAANLTETCNGICGGLTLSYPFGFSLGCPIQF
NCSAAGQGAKIGEFPVQNVTENSILVGVPTNCTRKIEDMTPLFGKQFTPSSENSFLMENC
VNPTNGCSINQRFLDKQLKSCESTGNISCFPSDTSSKSSEFLSMKELTNSSCRLLYTSIA
LESVGVNVGIAVEFERVRLGWWLMGGCENGTCVVNANCTDVYTPDGYAGHRCSCLEGYHG
DGYINPCLKLRG
Download sequence
Identical sequences Q8L8Y2
AT4G00955.1 NP_567202.1.80155 AT4G00955.1 3702.AT4G00955.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]