SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT4G09720.4 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G09720.4
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.79e-53
Family G proteins 0.00000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G09720.4
Sequence length 211
Sequence
MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSMQYKATIGADFVTKELQIGEKLVTLQ
IWDTAGQERFQSLGAAFYRGADCCALVYDVNVLRSFDNLETWHEEFLKQAWNIGMCPSDP
KTFPFIVLGNKIDVDGGSSRVVSDKKAADWCASNGNIPYFETSAKDDFNVDEAFLTIAKT
ALANEHEQDIYFQGIPDAVTENEPKGGGCAC
Download sequence
Identical sequences F4JKR7
NP_001190694.1.80155 AT4G09720.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]