SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT4G14920.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G14920.1
Domain Number 1 Region: 681-733
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000332
Family PHD domain 0.0024
Further Details:      
 
Domain Number 2 Region: 870-959
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000137
Family N-acetyl transferase, NAT 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT4G14920.1
Sequence length 1138
Sequence
MDRGGRRSGESPGVLIKKRSSSGCLIVKKNDGVGRICSFSESRPNWESNKRSRMITSDSE
SSDRFTIPRNMRQYRNVEESRFGWKRDCVEGKGDDCFVGNSREWKESKRHRLDDDDDNDD
DEESEDELMAMRMRRSFDGSGVDIGKKAYLGSAHFANDREYGTGSSRKGLDIEKRRKPYL
DGSGNIGFGNQGYRNRCKVSGNEAKTTHALLLQKKYKRDMNFDEPIRVQGKNGVLKVMVN
KQNKIGGLLQNAKAEQTQCGSTIQETGKIRVAIQLPNTLKTEKLPKLPPPARIQSNGLKL
PMSLTMKSKGQNQDSEDSDSSGRLQKRIIQPHKPSQMSSTGGEKTLPEASMPSKIRDGKI
RRGSGTEKQRLRERIREMLLEAGWTIDYRPRRNRDYLDAVYISPRGTAYWSIIKAYEALL
KQLNSGEKVAKPCDDSSTFSLISDEILSQLTRKTKSKIEKDMKRELHSASDSDGKATFAR
NFLAIKNEVGNDDRYVHKQQRNVMSVKNEVNSRDSSQGTTSKSESPLHHQTEKSTGSSSH
RVDGGKSSKHGRSTLLVRRSVRGDNSESDGFVPSSEKRTVLAWLIDSGTLQLSEKVMYMN
QRRTRAMLEGWITRDGIHCGCCSKILAVSKFEIHAGSKLRQPFQNIFLNSGVSLLQCQID
AWDKQKGAGNIGFCSVDVIADDPNDDACGICGDGGDLVCCDGCPSTFHQRCLDIRMFPLG
DWHCPNCTCKFCKAVIEDVTQTVGANTCKMCEKKYHKSCMPKANVTPADTTEPITSFCGK
KCKALSEGVKKYVGVKHELEAGFSWSLVHRECTNSDLSLSGHPHIVENNSKLALALTVMD
ECFLPIIDRRSGVNIVQNVLYNCGSNFNRLNFGGFYTALLERGDEIVASASIRFHGNRLA
EMPFIGTRHVYRHQGMCRRLFSVVESALQHLKVKLLIIPATADFSHVWISKFGFRQVEDS
LKKEMRSMNLLTFPGIDVLQKELLAPRHTESAVDTDCDPCNEGTNSAIKTNEVSVLETTS
PSRDKPVSDYLVEHQPYEDVSSASRDSLVHDGYPKMLETAFKTSTMARSSDMEKHMDCKT
SYSRFDGEDEEDSLIESPPQRNSDMAFLDHIIRSPVDTGATENRDVYGSGDDDSPETQ
Download sequence
Identical sequences C0SVH8
NP_001329379.1.80155 NP_193228.6.80155 AT4G14920.1 AT4G14920.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]