SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT4G19985.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G19985.1
Domain Number 1 Region: 148-219
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000169
Family N-acetyl transferase, NAT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G19985.1
Sequence length 237
Sequence
MGLVGCVGKSSLVSMELRWARRRKSDNAASALPRSIPIYISTLKKDINLEELRNLYSLCN
HSCNRLSEKDSNVEKIVDMKKLRRAISRSDVIVSVFCKPQHVDVDDAVLYSEEESLSSSL
YTSEFGRQNKDDSFLGDLFQNAVPLTPSNGQLVGFGRAYSDYGLTASIHDLMVLPSLQRM
GIGKLIVNRIVRLLTSRDIYDIAALCFEDERPFFKACGFGDDRMGSTTMMFTKSLEA
Download sequence
Identical sequences Q940H2
3702.AT4G19985.1-P AT4G19985.1 NP_001329418.1.80155 NP_567592.1.80155 AT4G19985.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]