SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT4G31110.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G31110.1
Domain Number 1 Region: 435-726
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-78
Family Protein kinases, catalytic subunit 0.0000964
Further Details:      
 
Weak hits

Sequence:  AT4G31110.1
Domain Number - Region: 345-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00202
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G31110.1
Sequence length 793
Sequence
MSNESTNCSFFLNLFMLLLLLIFYSADACQRECGGISIPYPFGIGKDCCLEKYYEIECRN
TTSRKLVPLLSFINKEVVSISLPSADSHFAYEVSDQERHESFGLVRVKFPITSAGCFNDG
KESGGGSKMNFTGSPFFIDRSNSLIAAGCNSKVSLMYIKPKMVGCELSCNTSKDSYSNSI
PFVEAGCSSNVLPYSQDQGCPEEIAEETGCNGIGCCQASLPNEPQQVIGIRTENNDGNST
TKVECTVSAFLTDEIYALPKATKTEHLLAKRYATVSLGWVIQTSNRSFLDSLALACKDRE
DYRNTTNLERKCTCGRITISETSYANCGCTYGYTGNPYVLNGCKDIDECKVKFEYCGKTE
TCVNFEGGYRCVRDKTKAIMIGAGTGFGVLVLVGGLWWLRKFLIKRRITKRKKKFFKRNG
GLLLLQELNTREGYVEKTRVFNSRELEKATENFSENRVLGHGGQGTVYKGMLVDGRTVAV
KKSKVIDEDKLQEFINEVVILSQINHRHVVKLLGCCLETEVPMLVYEFIINGNLFKHIHE
EESDDYTMLWGMRLRIAVDIAGALSYLHSSASSPIYHRDIKSTNILLDEKYRAKVADFGT
SRSVTIDQTHWTTVISGTVGYVDPEYYQSSQYTEKSDVYSFGVILAELITGDKPVIMVQN
TQEIVALAEHFRVAMKEKRLTDIIDARIRNDCKPEQVMAVAKVAMKCLSSKGKKRPNMRE
VFTELERICTSPEDSQVHNRIDEEEEEEEEEEEVVTTINRGDSWSISVTAPALSIVASSP
SSDVEPLFPRLTW
Download sequence
Identical sequences Q0WNY5
3702.AT4G31110.1-P AT4G31110.1 AT4G31110.1 NP_194840.3.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]