SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT4G37580.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G37580.1
Domain Number 1 Region: 44-161
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000000415
Family N-acetyl transferase, NAT 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G37580.1
Sequence length 403
Sequence
MTVVREYDPTRDLVGVEDVERRCEVGPSGKLSLFTDLLGDPICRIRHSPSYLMLVAEMGT
EKKEIVGMIRGCIKTVTCGQKLDLNHKSQNDVVKPLYTKLAYVLGLRVSPFHRRQGIGFK
LVKMMEEWFRQNGAEYSYIATENDNQASVNLFTGKCGYSEFRTPSILVNPVYAHRVNVSR
RVTVIKLEPVDAETLYRIRFSTTEFFPRDIDSVLNNKLSLGTFVAVPRGSCYGSGSGSWP
GSAKFLEYPPESWAVLSVWNCKDSFLLEVRGASRLRRVVAKTTRVVDKTLPFLKLPSIPS
VFEPFGLHFMYGIGGEGPRAVKMVKSLCAHAHNLAKAGGCGVVAAEVAGEDPLRRGIPHW
KVLSCDEDLWCIKRLGDDYSDGVVGDWTKSPPGVSIFVDPREF
Download sequence
Identical sequences Q42381
NP_195474.1.80155 AT4G37580.1 AT4G37580.1 3702.AT4G37580.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]