SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT4G37670.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G37670.2
Domain Number 1 Region: 81-318
Classification Level Classification E-value
Superfamily Carbamate kinase-like 7.03e-40
Family N-acetyl-l-glutamate kinase 0.001
Further Details:      
 
Domain Number 2 Region: 458-604
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.01e-21
Family N-acetyl transferase, NAT 0.015
Further Details:      
 
Domain Number 3 Region: 403-451
Classification Level Classification E-value
Superfamily Carbamate kinase-like 0.000000037
Family N-acetyl-l-glutamate kinase 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G37670.2
Sequence length 613
Sequence
MERGALVGSSSTSSYYVPYHFRQSKSNFSSFKPKNKLNPTQFRFNCSWFKPVSSITAAKC
NMFDYAVTAAGDVEAEHPVDDKQFVRWFREAWPYLWAHRGCTFVVIISGEIIAGSSCDAI
LKDIAFLHHLGIRFVLVPGTQEQIDQLLAERGREATYVGRYRVTDAASLQAAKEAAGAIS
VMLEAKLSPGPSICNIRRHGDRSRLHDIGVRVDTGNFFAAKRRGVVDGVDFGATGEVKKI
DVDRICERLDGGSVVLLRNLGHSSSGEVLNCNTYEVATACALAIGADKLICIMDGPILDE
SGHLIHFLTLQEADMLVRKRAQQSDIAANYVKAVGDGSMAYPEPPNNTNGNITSAQNGRA
VSFWGNGNHTPIFQNGVGFDNGNGLWPCEQGFAIGGEERLSRLNGYLSELAAAAFVCRGG
VKRVHLLDGTISGVLLLELFKRDGMGTMVASDVYEGTRDARVEDLAGIRHIIKPLEESGI
LVRRTDEELLRALDSFVVVEREGQIIACAALFPFFKDKCGEVAAIAVASDCRGQGQGDKL
LDYIEKKASSLGLEKLFLLTTRTADWFVRRGFQECSIEIIPESRRQRINLSRNSKYYMKK
LIPDRSGISVMRI
Download sequence
Identical sequences A0A178V1D0 B5X4Z4
NP_974701.1.80155 AT4G37670.2 AT4G37670.2 3702.AT4G37670.2-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]