SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT5G11340.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G11340.1
Domain Number 1 Region: 29-155
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.7e-28
Family N-acetyl transferase, NAT 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G11340.1
Sequence length 164
Sequence
MGAGREVSVSLDGVRDKNLMQLKILNTVLFPVRYNDKYYADAIAAGEFTKLAYYNDICVG
AIACRLEKKESGAMRVYIMTLGVLAPYRGIGIGSNLLNHVLDMCSKQNMCEIYLHVQTNN
EDAIKFYKKFGFEITDTIQNYYINIEPRDCYVVSKSFAQSEANK
Download sequence
Identical sequences A0A178UG73 Q9LFM3
GO.24470 AT5G11340.1 3702.AT5G11340.1-P NP_196695.1.80155 AT5G11340.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]