SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT5G16800.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G16800.1
Domain Number 1 Region: 22-198
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.21e-25
Family N-acetyl transferase, NAT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G16800.1
Sequence length 236
Sequence
MSRFPRGFVENSSMEEPKIARRPTICFRPINPSDLERLEQIHRDIFPIRYESEFFQNVVN
GGDIVSWAAVDRSRPDGHSEELIGFVTAKIVLAKESEISDLIRYDSSKGEGTLVYILTLG
VVETYRKRGIAKALINEVVKYSSGIPVCRGVYLHVIAHNNPAIRLYKRMSFRCVRRLHGF
YLINGQHFDSYLFVYFINGSRSPCSPLYVQNTSIFCILNSVCCDVSLRFLHRWGYR
Download sequence
Identical sequences A0A178UHL7 F4KFH9
GO.25270 AT5G16800.1 NP_197182.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]