SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT5G57020.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G57020.1
Domain Number 1 Region: 232-434
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.17e-86
Family N-myristoyl transferase, NMT 0.000000555
Further Details:      
 
Domain Number 2 Region: 45-231
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.73e-83
Family N-myristoyl transferase, NMT 0.00000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G57020.1
Sequence length 434
Sequence
MADNNSPPGSVEQKADQIVEANPLVKDDTSLETIVRRFQDSMSEAKTHKFWETQPVGQFK
DIGDTSLPEGPIEPATPLSEVKQEPYNLPSVYEWTTCDMNSDDMCSEVYNLLKNNYVEDD
ENMFRFNYSKEFLRWALRPPGYYQSWHIGVRAKTSKKLVAFISGVPARIRVRDEVVKMAE
INFLCVHKKLRSKRLAPVMIKEVTRRVHLENIWQAAYTAGVILPTPITTCQYWHRSLNPK
KLIDVGFSRLGARMTMSRTIKLYKLPDAPITPGFRKMEPRDVPAVTRLLRNYLSQFGVAT
DFDENDVEHWLLPREDVVDSYLVESPETHDVTDFCSFYTLPSTILGNPNYTTLKAAYSYY
NVATQTSFLQLMNDALIVSKQKGFDVFNALDVMHNESFLKELKFGPGDGQLHYYLYNYRL
KSALKPAELGLVLL
Download sequence
Identical sequences A0A178UUQ9 Q9LTR9
AT5G57020.1 NP_568846.1.80155 3702.AT5G57020.1-P AT5G57020.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]