SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G16905.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G16905.1
Domain Number 1 Region: 68-197
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-26
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 
Weak hits

Sequence:  AT1G16905.1
Domain Number - Region: 368-402
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0589
Family Pan module (APPLE domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G16905.1
Sequence length 423
Sequence
MALASHILILLSLFLLISLVRPQVPPMEQFRFLNNGDFGESTVEYGASYRDLGVIRNQFR
LCFFNTTPNAFTLAIGMGTGSSDSIIRWVWQANPQKPVQEEASLSFGPEGNLVLAQPDGR
VVWQTMTENKGVIGLTMNENGNLVLFDDGGWPVWQSFEFPTDTLLVGQSLTLDGSKNKLV
SRNNGSYSLILEPDRLVLNRLIPRSNNKSLVYHIIEGRFIPSATLYSAKDQGTTTQLGLA
TPGLRPEFPYKHFLARPRFNASQSFLRLDADGNLRIYSFDSKVTFLAWEVTFELFNHDNN
NECWLPSKCGAFGICEDNQCVACPLGVGLMGWSKACKPKKVKSCDPKSFHYYRLGGVEHF
MTKYNVGLALGESKCRGLCSGDCKCLGYFFDKSSFKCWISYELGTLVKVSDSRKVAYIKT
PNV
Download sequence
Identical sequences Q8GY81
3702.AT1G16905.1-P AT1G16905.1 NP_001077549.2.80155 AT1G16905.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]