SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G28160.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G28160.1
Domain Number 1 Region: 38-96
Classification Level Classification E-value
Superfamily DNA-binding domain 3.14e-21
Family GCC-box binding domain 0.00023
Further Details:      
 
Weak hits

Sequence:  AT1G28160.1
Domain Number - Region: 111-174
Classification Level Classification E-value
Superfamily BT0923-like 0.00523
Family BT0923-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G28160.1
Sequence length 245
Sequence
MEFNGNLNAGSCSRSKKSHRQKQQQPQPQPQQHIEEIKYVGVRRRPWGRYAAEIRNPTTK
ERYWLGTFDTAEEAALAYDRAARSIRGLTARTNFVYSDMPRGSSVTSFVSPDESQRFISE
LFNPPSQLEATNSNNNNNNNLYSSTNNQNQNSIEFSYNGWPQEAECGYQSITSNAEHCDH
ELPPLPPSTCFGAELRIPETDSYWNVAHASIDTFAFELDGFVDQNSLGQSGTEGFNSLPS
TFFYQ
Download sequence
Identical sequences Q9FZ90
AT1G28160.1 NP_174138.1.80155 AT1G28160.1 3702.AT1G28160.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]