SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G50680.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G50680.1
Domain Number 1 Region: 155-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.15e-26
Family B3 DNA binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 27-86
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000000203
Family GCC-box binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G50680.1
Sequence length 337
Sequence
MRLDDEPENALVVSSSPKTVVASGNVKYKGVVQQQNGHWGAQIYADHKRIWLGTFKSADE
AATAYDSASIKLRSFDANSHRNFPWSTITLNEPDFQNCYTTETVLNMIRDGSYQHKFRDF
LRIRSQIVASINIGGPKQARGEVNQESDKCFSCTQLFQKELTPSDVGKLNRLVIPKKYAV
KYMPFISADQSEKEEGEIVGSVEDVEVVFYDRAMRQWKFRYCYWKSSQSFVFTRGWNSFV
KEKNLKEKDVIAFYTCDVPNNVKTLEGQRKNFLMIDVHCFSDNGSVVAEEVSMTVHDSSV
QVKKTENLVSSMLEDKETKSEENKGGFMLFGVRIECP
Download sequence
Identical sequences Q9C6P5
AT1G50680.1 3702.AT1G50680.1-P AT1G50680.1 NP_175483.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]