SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G78830.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G78830.1
Domain Number 1 Region: 74-167,195-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.05e-26
Family alpha-D-mannose-specific plant lectins 0.005
Further Details:      
 
Weak hits

Sequence:  AT1G78830.1
Domain Number - Region: 405-437
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000275
Family Pan module (APPLE domain) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G78830.1
Sequence length 455
Sequence
MSRFAILVTLALAIATVSVVIAQVPPEKQFRVVNEGEFGEYITEYDASYRFIESSNQSFF
TSPFQLLFYNTTPSAYILALRVGLRRDESTMRWIWDANRNNPVGENATLSLGRNGNLVLA
EADGRVKWQTNTANKGVTGFQILPNGNIVLHDKNGKFVWQSFDHPTDTLLTGQSLKVNGV
NKLVSRTSDSNGSDGPYSMVLDKKGLTMYVNKTGTPLVYGGWPDHDFRGTVTFAVTREFD
NLTEPSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSD
GSLKAYSYFPAATYLKWEESFSFFSTYFVRQCGLPSFCGDYGYCDRGMCNACPTPKGLLG
WSDKCAPPKTTQFCSGVKGKTVNYYKIVGVEHFTGPYVNDGQGPTSVNDCKAKCDRDCKC
LGYFYKEKDKKCLLAPLLGTLIKDANTSSVAYIKY
Download sequence
Identical sequences Q9ZVA2
NP_565191.1.80155 3702.AT1G78830.1-P AT1G78830.1 AT1G78830.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]