SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G23390.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G23390.1
Domain Number 1 Region: 274-446
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.03e-38
Family FemXAB nonribosomal peptidyltransferases 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT2G23390.1
Sequence length 469
Sequence
MAVVLSYCKPSPPLRRFHRRCGNLWKKENVRSSRRSSSVTAMFWKSNKPAEVKEFDISLR
DYTLTESNIEEALENKPKQKVISLSVVSSIFEIPQAEWDACALDSSQPESYNPFLSYGFL
SSLEDTGCAVRETGWMPLHIVAKDECESILGVVPLYLKSHSYGEFVFDHSWADAYRSFGG
RYYPKLQCCVPFTPVTGPRILIRDNPCKEQVFDAIVSAMTELASKLQVSSLHITFPSGAE
WDKLKEKGFSQRIGMQYHWKNRDYKNFDEFLMDMKQSKRKNIRQERKKIGTQNLKMRRLQ
GDDIKARHWDSFYDFYRNTTDNKWGTPYLTRDFFHDMASKLGDKVLLVLAEENEEPVAGA
LNLIGGDTLFGRLWGCRPDSYYPSLHFEACYYQAIEAAIELNLKTVEAGAQGEHKIQRGY
LPVKTYSCHYIFDEGFRQAIDEFLVRESNQMDYVIRLMHEDGPFKEKIE
Download sequence
Identical sequences A0A178W2B7 O80456
NP_179920.1.80155 3702.AT2G23390.1-P AT2G23390.1 AT2G23390.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]