SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT3G12000.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G12000.1
Domain Number 1 Region: 73-167,199-229
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-31
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  AT3G12000.1
Domain Number - Region: 368-405
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0294
Family Pan module (APPLE domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT3G12000.1
Sequence length 439
Sequence
MRGVTPNYYHSYTFFFFFFVVLLALFLHVFSINTLSSTETLTISSNRTIVSPGNIFELGF
FKTTTSSRNGDHWYLGIWYKSISERTYVWVANRDNPLSKSIGTLKISYANLVLLDHSGTL
VWSTNLTRTVKSPVVAELLDNGNFVLRDSKGNYQNRFLWQSFDYPVDTLLPEMKIGRDLK
TGHETFLSSWRSPYDPSSGDFSFKLGTQGLPEFYLFKKEFLLYRSGPWNGVGFSGIPTMQ
NWSYFDVVNNFIENRGEVAYSFKVTDHSMHYVRFTLTTERLLQISRWDTTSSEWNLFGVL
PTEKCDLYQICGRDSYCDTKTSPTCNCIKGFVPKNVTAWALGDTFEGCVRKSRLNCHRDG
FFLLMKRMKLPGTSTAIVDKTIGLNECKERCSKDCNCTGFANKDIQNGGSGCVIWTGGAH
GYEELRRRRSRSICQNRPL
Download sequence
Identical sequences A0A178VHL2 Q9LHM1
AT3G12000.1 AT3G12000.1 3702.AT3G12000.1-P NP_187807.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]