SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT3G17880.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G17880.2
Domain Number 1 Region: 230-370
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.28e-32
Family Thioltransferase 0.00055
Further Details:      
 
Domain Number 2 Region: 97-206
Classification Level Classification E-value
Superfamily TPR-like 8.07e-24
Family Tetratricopeptide repeat (TPR) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G17880.2
Sequence length 373
Sequence
MVDAIQVAELRRFVEQLKLNPSILHDPSLVFFKEYLRSLGAQVPKIEKTAETKPSFSPKH
DDDDDDIMESDVELDNSDVVEPDNEPPQPMGDPTAEVTDENRDDAQSEKSKAMEAISDGR
FDEAIEHLTKAVMLNPTSAILYATRASVFLKVKKPNAAIRDANVALQFNSDSAKGYKSRG
MAKAMLGQWEEAAADLHVASKLDYDEEIGTMLKKVEPNAKRIEEHRRKYQRLRKEKELQR
AERERRKQQEAQEREAQAALNDGEVISIHSTSELEAKTKAAKKASRLLILYFTATWCGPC
RYMSPLYSNLATQHSRVVFLKVDIDKANDVAASWNISSVPTFCFIRDGKEVDKVVGADKG
SLEQKIAQHSSSK
Download sequence
Identical sequences NP_001078175.1.80155 AT3G17880.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]