SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT3G51710.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G51710.1
Domain Number 1 Region: 83-218
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.64e-19
Family alpha-D-mannose-specific plant lectins 0.0045
Further Details:      
 
Weak hits

Sequence:  AT3G51710.1
Domain Number - Region: 351-388
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000628
Family Pan module (APPLE domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G51710.1
Sequence length 476
Sequence
MMMKFYTFTFLICLFSKLQGHCKSDISLGNSLTLTSPLEYTPGFMGKAYIIETESSSTRE
PGFKAALTMESSDKDDGRYLCSLQIFLGDVRVWSSGHYSKMYVSSKCIIELTKDGDLRLK
SSYKHVGWRSGTSGQGVERLEIQSTGNLVLVDAKNLIKWQSFNFPTDVMLSGQRLDVATQ
LTSFPNDSTLFYSFEVLRDKIALFLNLNKLKYSYWEYKPREKNTTVNFVRLGLKGLDLFD
DNSRIIGRIEQPLIRFLALGNRTGNLGLYSYKPEKGKFEATFQAVSDTCDLPVACKPYGI
CTFSKSCSCIKVVSNGYCSSINGEEAVSVKRLCDHEMVELNGVTTVLRNGTQVRNISKER
CEELCKKDCECGAASYSVSEESCVMYGIVMGVKQIERVSGLSYMVKIPKGVRLSDEKSNV
RKWVVGLVGGIDGFVILLLISGFAFYFIRKRRKSLLLPPPPPPPPPLSQQPANTDS
Download sequence
Identical sequences Q9SCT7
AT3G51710.1 NP_190739.1.80155 AT3G51710.1 3702.AT3G51710.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]