SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT3G52850.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G52850.1
Domain Number 1 Region: 90-169
Classification Level Classification E-value
Superfamily PA domain 0.000000484
Family PA domain 0.022
Further Details:      
 
Weak hits

Sequence:  AT3G52850.1
Domain Number - Region: 508-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000223
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 281-388
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0492
Family Thioltransferase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G52850.1
Sequence length 623
Sequence
MKLGLFTLSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTV
VYPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADS
KAEPLITMDTPEEDKSDADYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVP
HPDERVEYELWTNSNDECGKKCDTQIEFLKNFKGAAQILEKGGHTQFTPHYITWYCPEAF
TLSKQCKSQCINHGRYCAPDPEQDFTKGYDGKDVVVQNLRQACVYRVMNDTGKPWVWWDY
VTDFAIRCPMKEKKYTKECADGIIKSLGIDLKKVDKCIGDPEADVENPVLKAEQESQIGK
GSRGDVTILPTLVVNNRQYRGKLEKGAVLKAMCSGFQESTEPAICLTEDLETNECLENNG
GCWQDKAANITACRDTFRGRLCECPTVQGVKFVGDGYTHCKASGALHCGINNGGCWRESR
GGFTYSACVDDHSKDCKCPLGFKGDGVKNCEDVDECKEKTVCQCPECKCKNTWGSYECSC
SNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIR
GIMAQYMPLESQPPNTSGHHMDI
Download sequence
Identical sequences P93026
3702.AT3G52850.1-P AT3G52850.1 NP_190853.1.80155 AT3G52850.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]