SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT3G58620.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G58620.1
Domain Number 1 Region: 486-681
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.36e-26
Family Thioltransferase 0.014
Further Details:      
 
Domain Number 2 Region: 211-303,355-435
Classification Level Classification E-value
Superfamily TPR-like 4.37e-26
Family Tetratricopeptide repeat (TPR) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G58620.1
Sequence length 682
Sequence
MSHYRRHSLEPSITSKFRDSLSFQRDDDVINKPDFRELDFGSPLRPRGSSSAAATPAASG
SSSSSSGSASGKPAVTSQFARRSHSGELSGLSQTSPVKPGSVNRNLKPGHRRSASAGTPL
IYSGLGFSPVNNNNNSSRGGGSGATSPNPGVLPTGNICPSGRILKTGMATRASVRPETLC
TGTANYGHGNIIRTGGKVSHATKAAAEMSDSEEVKKAGNVMYRKGNYAEALALYDRAISL
SPENPAYRSNRAAALAASGRLEEAVKECLEAVRCDPSYARAHQRLASLYLRLGEAENARR
HLCVSGQCPDQADLQRLQTLEKHLRLCTEARKIGDWRTVISEIDAAIANGADSSPQLVAC
KAEAFLRLHQIKDSDLCISSIPRLDHHHTQPPEKLFGIVCDAYVLCVQAQVDMALGRFEN
AIVKVERAMTIDHSNSPEVVSVLNNVKNVAKARTRGNELFSSGRYSEASVAYGDGLKLDA
FNSVLYCNRAACWFKLGMWEKSVDDCNQALRIQPSYTKALLRRAASYGKLGRWEDAVRDY
EVLRKELPGDSEVAESLQRARNALSNKSEEPKYLGFNNEVEEVSTLDKFKTATSLPGISV
FHFKSSSNRQSEAISPFVNTLCLRYPLVHFFKVDVEESLALAKAESIKKIPTFKIYKKGE
KVKEMVCPSHQLLEDSVTHFLL
Download sequence
Identical sequences A0A178VKQ3 Q84JR9
AT3G58620.1 3702.AT3G58620.1-P NP_191421.2.80155 AT3G58620.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]