SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT4G31100.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G31100.1
Domain Number 1 Region: 426-717
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-77
Family Protein kinases, catalytic subunit 0.0000918
Further Details:      
 
Weak hits

Sequence:  AT4G31100.1
Domain Number - Region: 330-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00023
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G31100.1
Sequence length 786
Sequence
MSYKNTNNSHLILFKLLLLLILYSADLTASSSCRSECGGCKCGGIAIPYPFGIGKGCYLE
KSYEIECLNTSGKLVPFLSVISKEVVSIHLPGRQSFGSVRVRSPITSAGCSSDGKDSAPV
MNLTDSPFFVSDINNLVGVGCSSKVSLEHIKQNMVGCELNCSTTNASDSNSIPFFDKTGC
SFSYTFAQVCTGNKPEDMGCDGRGCCQASLPREPQQVIGIRIESNDGKSTTSGDCRVAFL
TDEFFSLSKLTKPEQLHAKRYATLSLGWIMQTRNTSFVNSLACKIRKDTDTAYSNDQSIK
CICDYTMSIISDIRYANCECNLGYKGNPYDSDGCRDIDECKENPKYCKETDTCVNFEGGY
RCVGDKTKAIMIGAGTGFGVLVLVGGVWWLRKFLVKRRMAKRKKKFFKRNGGLLLQQELN
TRQGVVEKARIFTSKELEKATENFSENRVLGHGGQGTVYKGMLVDGRTVAVKKSKVIDED
KLQEFINEVVILSQINHRHVVKLLGCCLETEVPILVYEFIINGNLFKHIHEEEADDYTMI
WGMRLRIAVDIAGALSYLHSAASSPIYHRDIKSTNILLDEKYRAKVADFGTSRSVTIDQT
HWTTVISGTVGYVDPEYYRSSQYTEKSDVYSFGVILAELITGDKPVIMVQNTQEIIALAE
HFRVAMKERRLSDIMDARIRDDSKPEQVMAVANLAMKCLSSRGRNRPNMREVFTELERIC
TSPEDSQVQNRIDEEEEEDGVEEEEEVVTIVHRGDSWSIGVTAPASSIVASPPSSDVEPL
NPLLTW
Download sequence
Identical sequences Q9M092
3702.AT4G31100.1-P AT4G31100.1 AT4G31100.1 NP_194839.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]