SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT5G03700.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G03700.1
Domain Number 1 Region: 78-193
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000107
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Weak hits

Sequence:  AT5G03700.1
Domain Number - Region: 354-391
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000216
Family Anti-platelet protein 0.078
Further Details:      
 
Domain Number - Region: 218-281
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000366
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G03700.1
Sequence length 482
Sequence
MEGLCLNSFTRVLLLLFVFLVFSHKWQRVNAVEPVLELVKGFEAKPDSSIDSFQPLLTDS
NGNFSFGFLRVNGSRLSLAVTHPNLTDPLWVLDPTRSASWSHKTKLFFNGSLVIIDPSSR
LEWSTHTNGDRLILRNDSNLQVVKTSTFVEWESFDFPGNTLVESQNFTSAMALVSPNGLY
SMRLGSDFIGLYAKVSEESQQFYWKHSALQAKAKVKDGAGPILARINPNGYLGMYQTGSI
PIDVEAFNSFQRPVNGLLILRLESDGNLRGYLWDGSHWALNYEAIRETCDLPNPCGPYSL
CTPGSGCSCIDNRTVIGECTHAASSPADFCDKTTEFKVVRRDGVEVPFKELMDHKTTSSL
GECEEMCVDNCKCFGAVYNNGSGFCYLVNYPIRTMLGVADPSKLGYFKVREGVGKKKSRV
GLTVGMSLLAVIALVLMVAMVYVGFRNWRREKRVLEEDNGLSPGPYKNLGSDSFNSVEMS
RR
Download sequence
Identical sequences A0A178UCA7 Q9LZR8
NP_195990.1.80155 AT5G03700.1 3702.AT5G03700.1-P AT5G03700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]