SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT5G18470.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G18470.1
Domain Number 1 Region: 75-171,203-231
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.11e-16
Family alpha-D-mannose-specific plant lectins 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G18470.1
Sequence length 413
Sequence
MALSIVLLPFILILIPTFLSSVFAVSPLKTDTLKPGQQLRDWEQLISADGIFTLGFFTPK
DSSTSELGSAGLRYLGIWPQSIPINLVWVGNPTESVSDSSGSLSIDTNGVLKITQANAIP
ILVNQRPAAQLSLVGNVSAILLDTGNFVVREIRPGGVPGRVLWQSFDHPTNTLLPGMKIG
FNLRTKKEVSVTSWITDQVPVPGAFRLGLDPSGANQLLVWRRGEIYWSSGILTNNGSSHL
NLEVSRHYIDYEFKFDSNKYMKYFSYSIKKANSSVFSSWFLDTLGQITVTFSLSSNNSST
WISESSEPCKTDLKNSSAICITEKPTACRKGSEYFEPRRGYMMENNTGYYPFYYDDSLSA
GLSDCHGTCWRNCSCIAFQAFPDGCQYWEKGSKFVPYDSFNSNLVTYVLDSVK
Download sequence
Identical sequences A0A178U7R3 Q94K76
NP_197348.1.80155 3702.AT5G18470.1-P AT5G18470.1 AT5G18470.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]