SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G50320.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G50320.1
Domain Number 1 Region: 137-376
Classification Level Classification E-value
Superfamily Radical SAM enzymes 7.85e-29
Family Oxygen-independent coproporphyrinogen III oxidase HemN 0.034
Further Details:      
 
Domain Number 2 Region: 373-560
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000348
Family N-acetyl transferase, NAT 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G50320.1
Sequence length 565
Sequence
MATAVVMNGELKKQPRPGKGGYQGRGLTEEEARVRAISEIVSTMIERSHRNENVDLNAIK
TAACRKYGLARAPKLVEMIAALPDSERETLLPKLRAKPVRTASGIAVVAVMSKPHRCPHI
ATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSV
DKVEFILMGGTFMSLPAEYRDFFIRNLHDALSGHTSANVEEAVAYSEHSATKCIGMTIET
RPDYCLGPHLRQMLIYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVV
AHMMPDLPNVGVERDMESFKEFFESPSFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPP
EQLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVR
TREAGIQDIHHKIKPEQVELVRRDYTANEGWETFLSYEDTRQDILVGLLRLRKCGKNVTC
PELMGKCSVVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEEAERIARREHRSNKIGVIS
GVGTRHYYRKLGYELEGPYMVKHLL
Download sequence
Identical sequences A0A178UGS1 Q93ZR1
AT5G50320.1 3702.AT5G50320.1-P NP_568725.1.80155 AT5G50320.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]