SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41409991|ref|NP_962827.1| from Mycobacterium avium subsp. paratuberculosis K-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41409991|ref|NP_962827.1|
Domain Number 1 Region: 147-402
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-44
Family Protein kinases, catalytic subunit 0.0006
Further Details:      
 
Domain Number 2 Region: 523-699
Classification Level Classification E-value
Superfamily TPR-like 0.000000949
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|41409991|ref|NP_962827.1|
Sequence length 763
Comment PknG [Mycobacterium avium subsp. paratuberculosis K-10]
Sequence
MAEPDNKSEQPEPGAEQMGPGTQPAEVGDDAQAGAATGRLQATQALFRPDFDDDDDDFPH
ISLGALDTDSADRMTVATQALPPVRQLGGGLVEIPRGRDIDPREALMTNPVVPESKRFCW
NCGKPVGRSTKKSKGTSEGWCPHCGSAYSFLPQLNPGDIVANQYEVKGCIAHGGLGWVYL
AVDHNVNDRPVVLKGLVHSGDAEAQAIAMAERQFLAEVVHPQIVQIFNFVEHVDRHGNPV
GYIVMEYVGGQPLRHGKGEKLPVSEAIAYVLEILPALGYLHSIGLVYNDLKPENIMLTEE
QLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLNLPTRNG
RYVDGIPDNDPVLGTYDSFRRLLRRATDPDPRRRFSSTEEMSAQLMGVLREVVAHDTGVP
RPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHSEKLTAREIVTALQVPLVDPADVAAPV
LQATVLSQPVQTLDSLRAARHGTLDADGVELSESIELPLMEVRALLDLGDVAKATRKLDD
LAERVGWQWRLVWYKAVAELLTGDYDSATTHFTEVLDTFPGELAPKLALAATAELAGDVD
EHRFYETVWKTNDGVISAAFGLARTLSAEGDRAAAVRTLDEVPATSRHFTTARLTSAVTL
LSGRSKSEITEEEIRDAARRVEALPPTEPRVLQIRALVLGCAMDWLEDNKASTNHILGFP
FTEHGLRLGVEAALRNLARVAPTQRHRYALVDMANKVRPTSTF
Download sequence
Identical sequences A0A202FS53 Q73T26
WP_010950156.1.10000 WP_010950156.1.101064 WP_010950156.1.1614 WP_010950156.1.17915 WP_010950156.1.22949 WP_010950156.1.26008 WP_010950156.1.27804 WP_010950156.1.35606 WP_010950156.1.37369 WP_010950156.1.37642 WP_010950156.1.40837 WP_010950156.1.45459 WP_010950156.1.45501 WP_010950156.1.59922 WP_010950156.1.646 WP_010950156.1.66027 WP_010950156.1.66905 WP_010950156.1.6888 WP_010950156.1.81559 WP_010950156.1.8174 WP_010950156.1.82097 WP_010950156.1.82175 WP_010950156.1.82859 WP_010950156.1.83216 WP_010950156.1.88396 WP_010950156.1.89157 WP_010950156.1.9350 WP_010950156.1.98852 gi|499078286|ref|YP_007973764.1| 262316.MAP3893c gi|41409991|ref|NP_962827.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]