SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAEL000057-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL000057-PA
Domain Number 1 Region: 4-396
Classification Level Classification E-value
Superfamily L domain-like 8.84e-47
Family Ngr ectodomain-like 0.046
Further Details:      
 
Domain Number 2 Region: 644-796
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 7.06e-45
Family Toll/Interleukin receptor TIR domain 0.00021
Further Details:      
 
Domain Number 3 Region: 450-584
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000119
Family Ngr ectodomain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL000057-PA   Gene: AAEL000057   Transcript: AAEL000057-RA
Sequence length 815
Comment pep:novel supercontig:AaegL1:supercont1.1:3603864:3620514:1 gene:AAEL000057 transcript:AAEL000057-RA
Sequence
MDLSDNYFQGFRDLTTLRLDFGIENLPTSLFKELTMLERLTLTAQLKKLPIDLLINQNQL
VELILKNNRIEEIPFDFFRHQNNLIHLDLSANRLQSIAEITFANLTSLIHLDMSHNAIQS
VHANAFHNMQKLKYLSLKSNELTHVPPTLLKGLTLLANLDLSANQLRLLPPDLLRNHTQL
FRSDLSKNDIETLPEMLFETNAALQYVNISHNSLITLPSKLFHTLQKLISLDLSNNQLSS
LDPDIFEQSPYVIFLYLQNNHLWFAGSLYRNEHDLEESSFSPFWPIRMQLRELNLRNNSI
DRVDIAWIESPELKKLDLSYNKLSKFDNDDFKFRSNEMVVDLEFNQIAMLSLMAMDATKG
SDGFNLFKLNHNPLNCDCQVTSFVQFLQMTGHVYRRWRFTVDHLRCVEPDLNRGINVVKV
NVANLLCKIDEHCPERCSCFVRKSNESVLVNCEQKNLTKLPNLTNVSLNFNDVELYLKNN
SIKSFDLPTSCGYEKVKKFDASYNQFQNLSSDLLLGVKILDISNNNLSSFIELTNLLNNS
RQLSSVKLSSNPWQCDCPSIDHLRVIQTTSDRIEDSKYMRCSDGRDLNLLTVSDVCHVDV
ITTIIISMCLVIILILLITFVAYAYQIEIKIWLFTNNLCLRLVTEEEIDKDKLYDAFVSY
CHQDEEFVSSTLVPRLETAPMNLKVCWHMRDWNPGEVITTQIVHSIENSRRTIVVLSRDF
LESSWGQLEFRTAHVSSMAEKRVRVIIIIYGDLGDEDRIDSEMKAYLKTNTYIKWGDPWF
WQKLRYAMPHPARVKGVRWYRERNRVDIAPTVEVN
Download sequence
Identical sequences AAEL000057-PA 7159.AAEL000057-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]