SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAEL000103-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL000103-PA
Domain Number 1 Region: 12-91
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000527
Family V set domains (antibody variable domain-like) 0.063
Further Details:      
 
Domain Number 2 Region: 114-148,204-261
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000853
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL000103-PA   Gene: AAEL000103   Transcript: AAEL000103-RA
Sequence length 265
Comment pep:novel supercontig:AaegL1:supercont1.2:821661:842014:-1 gene:AAEL000103 transcript:AAEL000103-RA
Sequence
MSQAYFATRNNTKVTAQKGGTALLPCTVLTQTSALVSWVRRRDFQLLTVGLSTYSSDERF
LVHHIRHMGHWALRIKAVRDEDQGLYECQLSVHPVQSVFVELKVVDAVADIVGAPDLHID
EGSTLRLECKLKRATEYPDYVFWYHQESMVNFDQQNGFSVTPFQPKPRASSSTPSSTSST
PIATTGSNNDSGELLATDLTAGFSAAEEQLHQWALNQSGFLPYSHILSPATSVLTIKEVH
SKHAGNYTCAPSNTRPASITVHVLQ
Download sequence
Identical sequences Q17Q64
7159.AAEL000103-PA AAEL000103-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]