SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAEL001373-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL001373-PA
Domain Number 1 Region: 160-231
Classification Level Classification E-value
Superfamily Homeodomain-like 4.28e-19
Family Homeodomain 0.0031
Further Details:      
 
Domain Number 2 Region: 46-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000014
Family LIM domain 0.011
Further Details:      
 
Domain Number 3 Region: 14-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000921
Family LIM domain 0.0087
Further Details:      
 
Weak hits

Sequence:  AAEL001373-PA
Domain Number - Region: 101-147
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0228
Family Pyk2-associated protein beta ARF-GAP domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL001373-PA   Gene: AAEL001373   Transcript: AAEL001373-RA
Sequence length 391
Comment pep:novel supercontig:AaegL1:supercont1.31:1978477:1987371:1 gene:AAEL001373 transcript:AAEL001373-RA
Sequence
MCLNIVGTIKSEKTQEICEGCGQKIKDRYFMKLSPDQYWHEQCLLCCICHIQLNQSCYMK
NTKLYCKDDYYRVSRDCYGCGERIAPNEMVMRAKALVYHLNCFLCYTCNRPLQKGEPFSL
RAGKLICQHDLEKDMYSTLHPMHPHHNQHTLFSEDDYLLEDGLRSRDGRRGPKRPRTILT
SVQRRQFKASFDVSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKISRKSKAAQSN
GNSDGDKSHSDKEDKSIKLESPVSDHSHYLGVDGSFGSTSQPLNPNLPYSPDFPENSDAS
MCSSDISLDESFDNLDEATSDTMSLQNLDLQTSLNSSSNSNNSTNNTNTSASLVNHNNNN
INGLMPGTNITHIDKLYLMQNSYFNGTSIEQ
Download sequence
Identical sequences Q17LD3
AAEL001373-PA 7159.AAEL001373-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]