SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAEL003652-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL003652-PA
Domain Number 1 Region: 226-557
Classification Level Classification E-value
Superfamily Subtilisin-like 6.28e-96
Family Subtilases 0.000000000495
Further Details:      
 
Domain Number 2 Region: 550-688
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-39
Family Proprotein convertase P-domain 0.00017
Further Details:      
 
Domain Number 3 Region: 137-208
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.87e-21
Family Prohormone convertase 1 pro-domain 0.0012
Further Details:      
 
Domain Number 4 Region: 751-783,871-897
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000447
Family Growth factor receptor domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL003652-PA   Gene: AAEL003652   Transcript: AAEL003652-RA
Sequence length 1059
Comment pep:known supercontig:AaegL1:supercont1.94:1002252:1428939:-1 gene:AAEL003652 transcript:AAEL003652-RA
Sequence
MPCPAASRRLSGSGNSAEQSNSSSSSSSRRRSRSSSSSRLWCWHRSSPALVLYIVGVVLV
GAISTVYCDAVSSGGSSSSSSSVSSNSNPNQRGGDNAVVDGGQHLVSGESNAVEQDDAFG
SGSVGACEDHYEGSGHYTHHWAVHIPEGGGETAEQVADEHGFINHGKIFDGYYHFEHRHL
QKRSLNPSGHHQRRLDGDDRVRWAKQQRAKRRPKRDFRPLKSPYTIQLNDPKWGEMWYLN
RGNGLDMNVIPAWKEGVTGKGVVVTILDDGLESDHPDLEHNYDPKASYDVNGNDGDPMPH
YDLTDSNRHGTRCAGEVAATANNSKCAVGIAYGARVGGVRMLDGDVTDVVEAKSLGLNSQ
HIDIYSASWGPDDDGKTVDGPGDMATRAFIEGVRKGRGGKGSIFIWASGNGGREHDNCNC
DGYTNSIWTLSISSASQEGLVPWFSEMCSSTLATTYSSGNTNEKQVITTDLHHSCTSSHT
GTSASAPLAAGIAALVLEANPNLTWRDLQHIVVRTAKPGNLKDPTWSKNGVGRRVSHSFG
YGLMDAAAMVKLARTWKTVPEQQICEINAPHLDKQIPPRTKVTLQLVVEHCKGVNYLEHV
QAKITLTSQRRGDIQIFLTSPSGTRVTLLTPRSHDLSRSGFNQWPFMSVHTWGEAPHGTW
QLEIHNEGRLLAQITHWNLIFYGTETPAQPDDPVRLGKPGFSDSNYGGEIEHNSLEFDNG
ITSDQWRNMQQIGESHVDVQRTASSDVTASVCAKYSGALCIDCGSSSYLYKGRCYSTCPD
STFPSDAVPSGPPNNDDEATIKESAFIEQQPLPKGSLRRSTAAAIAFQLVDDNSNNLDND
ALLVPVAKPSPQERDTQPHEQQEQDQESRLCIQCHPTCLKCFGPDEFQCTECQPLFAFVV
DGDNDVNASHPSSDVGLPNQRRHCVSITGKQRSGGTNKSRPNVTLSYQDDSQKSDKSWQS
FDYLIMITAVGATLVVAFAVIYLMWRRCFRGVLLGSGVGSGGTADYQYDRVRTDEANAGS
EPSYAELVRDEIDDILGESSSDESGGSFMATRIIAPLER
Download sequence
Identical sequences Q17EV1
7159.AAEL003652-PA AAEL003652-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]