SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAEL003837-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL003837-PA
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 9.81e-40
Family MIR domain 0.0027
Further Details:      
 
Domain Number 2 Region: 1086-1179
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-19
Family SPRY domain 0.028
Further Details:      
 
Domain Number 3 Region: 665-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000396
Family SPRY domain 0.077
Further Details:      
 
Domain Number 4 Region: 4194-4253
Classification Level Classification E-value
Superfamily EF-hand 0.00000000541
Family Polcalcin 0.042
Further Details:      
 
Domain Number 5 Region: 98-181
Classification Level Classification E-value
Superfamily MIR domain 0.000000471
Family MIR domain 0.025
Further Details:      
 
Domain Number 6 Region: 2251-2335
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000131
Family IP3 receptor type 1 binding core, domain 2 0.016
Further Details:      
 
Weak hits

Sequence:  AAEL003837-PA
Domain Number - Region: 3082-3466,3602-3650,3847-3880
Classification Level Classification E-value
Superfamily ARM repeat 0.00192
Family MIF4G domain-like 0.086
Further Details:      
 
Domain Number - Region: 464-630
Classification Level Classification E-value
Superfamily ARM repeat 0.0023
Family GUN4-associated domain 0.085
Further Details:      
 
Domain Number - Region: 1515-1640
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00273
Family SPRY domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL003837-PA   Gene: AAEL003837   Transcript: AAEL003837-RA
Sequence length 5118
Comment pep:novel supercontig:AaegL1:supercont1.98:2038222:2111358:-1 gene:AAEL003837 transcript:AAEL003837-RA
Sequence
MAEAEGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLS
QCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHNNSDMYLACLSTS
SSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NDLSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGQEPG
QNMVVYEGGSVMSQARSLWRLELARTKWAGGFINWSHPMRIRHLTTGRYLGVNENNELIL
MSRELATTSQTAFVLRAEKDDQKVVLEDKDLEVIGAPIIKYGDSTVIMQHHESGLWVSYK
SYETKKKGVGKVEEKQAVLHEEGKMDDGLDFSRSQEEESRTARVIRKCSHLFTKFIGGLE
TLQQNRRHSFFLQTINLGEMVMCLEDLINYFAQPEDDMEHEERQNRLRALRNRQDLFQEE
GVLNLILEAIDKINVISSQGFLASFLASDETGQSWEMISGYLYQLLAAIIKGNHTNCAQF
ANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTSLVDHVASVRPNIFVGRVEGS
AVYQKWYFEVTMDHIEQTTHMSPHLRIGWANTNGYVPYPGGGEKWGGNGVGDDLFSYGFD
GVFFWSAGRRTQVVFSDISEPFIKKNDVIGCTLDLSVPVIRFTFNGEPVHGCFTDFNLDG
MFFPVISCSSKLSCRFLFGGDHGRMKFNPPPGFSPLVQCLMPHQNLSLDPCFFFGNLNKN
VLAGPWLVEDDSAFVPKPVDTSSVTLPSSVETIKDKLAENIHEMWALNKIEAGWTWGERR
DDLYRIHPCLTSFEKLPAAEKRYDCQLAVQTLKTILSLGYYISMDKPPARIRPIRLPNDP
YMQGNGYKPAPLDLSAAVLNPKMEELIDLLAENTHNLWAKERIQQGWTYGLNEDGENRRS
PHLVPYSKVDEAIKKANRDTASETVRTLLIYGYNLDPPTGEANEALAAEAFRQKFSAFRT
YRAEKNYAVTSGKWYFEFEVLTAGPMRVGWARADCNPGTMLGSDDSSWAFDGYNARKLHL
HTVEDFGRRYQVGDIIGCLINVTDKTTSFSLNGELLMDALGGETTFADVTAPEGVGFVPA
CTIGIGQKARVVYGQDVDSLKWFTTCGLQEGYEPFCVNMKRAVTHWYTKDQPIFENNEDI
PDCKIDVTRIPGGADTPPCLKISHNTFETMEKANWEFLRLSLPVTCDASFIDESEKMHRW
EEIRIRQHRLLMEAEHQAQPSGAHMDHIMKSGFTMNDLKGLQRNYSEDGVESDEVMRHGP
QRPTRASRRAEALSPPGIEINGEMHMSDPENAYSDHEMEDDRKKRGRSPFRLFGKKRDQS
KDKLKDQRMPEPEPRKGTMQQRTVARSPTMRASNADVRGAAQMAAERKSMGSPQGVESFG
NEVYDADCLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHVHSKEFNQDKVRHAAIYVED
EGETTVEVVNRQSCYMVRADELFNEVTQDASGKGASQGMFVGCFVDTATGTIRFTCEGKE
TSHVFLMEPETKLFPAIFVEATSKEILQIELGRTPTTLPLSAAVLPTGDKHINPQFPPRL
KVQCLKPHQWARVPNTALQVHALKLSDIRGWSMLCEDPVSMLALHIPEEDRCIDILELIE
MDRLLSFHAHTLTLYSALCYQSNYRAAHALCNHVDQKQLLYAIQSEYMSGPLRLGFYDLL
IALHLESHANTMEVCKNEFIIPLGPELKDLYVDPEMCHSLRSLQTLSVRPQMNMTEIASP
SPPQSNLPTIVAPDSSSEPIPAIDSLYSPRFPLEVVREFVMAALKEAVEINQVHNRDPIG
GSNENLFLPLIKLIDRLLLVGVITNEDVEKLLIMIDPETWDPLFEKEGKDEHRKGLLTMK
MAEGAKLQMCYLLHHLYDVQLRHRTESIIAFAHDYVCDLQQDQLRRYIEIKQSDLPSAVA
AKKTREFRCPPREQMNAILCFKNLEGEDLENCSCGSELRERLIEFHEKLMGKVSLNALQE
PEEESAEPVDESKPGALKKLYNFINAVKELEEDPKEPEEVERKTPEEVFRKVLIKQIVSW
AEESQIENPKLVREMFGLLVRQYDTIGELINALNKTYVINSKTTGDVANMWVGLSQIRAL
LPVQMSQEEEELMRKRLWKLVNNHTFFQHPDLIRILRVHENVMAVMMNTLGRRAQAQSDA
PVQSAEGEEAQPKEKDTSHQMVVACCRFLCYFCRTGRQNQRAMFDHFDFLLENSNILLSR
PSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSELIERGYPDLGWD
PVEGERYLDFLRFCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLLKAIIDANK
MSEKIAERRKMQDEAEGTIAGLGFSHPLPEGDDDEDYIDTGAAILCFYCTLVDLLGRCAP
DASVIEQGKNESLRARAILRSLVPLEDLQGVLGLKFTLTNPAAGEERPKSDMPSGLVPGH
KQSIVLFLERVYGIETQELYYRLLEDSFLPDLRAATILDRSDGSESDMALSMNRYIGNSI
LPLLIKHSKFYNEAENYASLLDATLHTVYRMSKNRMLTKGQREAVSDFLVALTSAMHPAM
LLKLLRKLTVDVSKLSEYTTVALRLLTLHYDRCAKYYGTTGSGQASQFGASSDEEKRLTM
LLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKNSDDDLYGKPTTSPDQPH
YNPQPIDTTIVQLTNDLNQIIQKFSEHYHDAWASKKFENGWSYGDQWSDSNKTHPRLKPY
TMLSEYEKERYREPVRESLKALLALNWRVDHSEVDVPHSNRGSMRRQSKPNLELQGDTGS
PFNYNPHPVDMTNLTLSREMQNMAERLAENSHDIWAKKKFEELHQCGGAVHAQLVPYDLL
TDKEKRKDRERSQEFLKYLQYQGLKLHKPSRGMTEEPGVTAAAIEARFAYSLLEKLISYI
DRATINMKLLKPSTTFSRRSSFKTCSRDIKFFSKVVLPLIEKYFSTNRNYFIAIATATNN
VGAASLKEKEMVASLFTKLASLLRYRMAAFGADVRITVRCLQVLVKSIDAKSLTKACPEF
IRTSMLTFFNNTADDLGQTIFNLQEGKYDRLRGTHLKTSTSLAYVNQVILPVLTALFDHL
AACDYGSDLLLDEIQVASYKILSSLYTLGTDTTLTRDRKYLKTEIERHKPALGSCLGAFS
SCFPVAFLEPHANKHNPFSLLNRIADTSLEAQDIMTKMESSMPTLETILSEVDHFVESEK
TYQDAQHIIDVILPLLCSYLPFWWNQGPDNVSPQSGNHVTMVTADHMNLLLKNVLKMIKK
NIANENAPWMTRIASFTQQIIINSSEELLKDVFLPLAERVKKRVDSMFHKEESLRGFLKS
STDDTSQIEAQIQEDWQLLVRDIYSFYPLLIKYVDLQRNHWLKDNIAEAEELYNYVAEIF
NVWSKSQYFLKEEQNFISANEIDNMALIMPTATRRTAAVSGDMPAAGGKVKKKKRARDKK
RDKDKEIQSSLMVACLKRLLPVGLNLFAGKEQELVQHCKDRYLKKMPEYEVIEFAHTQLT
LPDKLDPADEMSWQHYLYSKLGKKEDAIVQESVEKADKKQGNKIEETVERIVAMAKVLYG
LHMIDHPQQQSKNVYRSCVSIQRKRAVIACFRHVSLHSLPRHRACNIFARTYYELWLEDE
NVGQEVMIEDLTQTFEDAEKKKKEEEEEEGKPDPLTQLVTTFCRGAMTERSGALQEDALY
MSYASIVARSCGEEEEEGGDEEEGGGGGEDEGGASIHEQEMEKQKLLFHQARLANRGVAE
MVLLHISASKGIPSDMVMRTLQLGIAILRGGNIDIQMGMLNHLKEKKDVGFFTSIAGLMN
SCSVLDLDAFERNTKAEGLGVGAEGAAGEKNMHDAEFTCALFRFIQLTCEGHNLDWQNYL
RTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKELIDSAGKANFFKAIGVASQVFN
TLTEVIQGPCTQNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDM
ITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLKDLTSTPSFMEIDPN
GDGWILPKDFREKMEQQKSYTPEEIDFLLACCETNHDGKIDYIGFVDRFHEPAKEIGFNL
AVLLTNLSEHMPNEPRLARFLETAGSVLNYFESFLGRIEIMGSSKRIERVYFEIKEANIE
QWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMASDEDGGNVRR
EAAFTYISEEEEERAARDPIKRTIQAIKDGLSYSVYMISPSNIKHQIAVLQSKSFPEIIV
GFFKMIFYAFYYSGFGVSIIIKYLVNILMSLMRGSTQEEEEVIVEVEPSLRALPPLPTEE
PPSTVQAFGLDISKEENGQYRVQPHESPALSPSSSVEETGESSPEDGAGELSAEAASTEP
PMTLVDLLGGEAAKRAAQERSEAQKAQEATLANIEAEQKKASAETKEPAAVTQIDFSKYT
KKAVSFLARNFYNLKYVALVLAFGINFMLLFYKVTTLGDDEASEGSGDDMMELASGLGSG
LAEAVLEGGSGDGGSGDGGDEGDGEDPLEKVEVDEDFFYMEHVMRVAALMHSLVSLCMLI
AYYHLKVPLAIFKREKEIARRLEFDGLFIAEQPEDDDIKSHWDKLVISAKTFPVNYWDKF
VKKKVRQKYSETYDFDSISNLLGMEKNAFAAQESSEGGGFFHFIANIDWRYQIWKAGVTI
TDNAFLYSLWYFIFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLL
TIIVYIYTVIAFNFFRKFYIQEDDDGEEGDRKCHDMGTCFVFHLYKGVRAGGGIGDEIGD
PDGDEYEVYRILFDISFFFFVIVILLAIIQGLIIDAFGELRDQLESVKEDMESNCFICGI
GKDYFDKVPHGFDTHVAQEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRCWDFFP
VGDCFRKQYEDELSGGGS
Download sequence
Identical sequences Q17EB5
AAEL003837-PA 7159.AAEL003837-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]