SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAEL004491-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL004491-PA
Domain Number 1 Region: 11-62
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000222
Family Calponin-homology domain, CH-domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL004491-PA   Gene: AAEL004491   Transcript: AAEL004491-RA
Sequence length 1129
Comment pep:novel supercontig:AaegL1:supercont1.121:61326:310248:1 gene:AAEL004491 transcript:AAEL004491-RA
Sequence
MKRLPTHGLYDNVNSCLTVLRQHQVGGLESVTPNDICSGRLKAVLSLFFALSRYKQATKQ
KAAAAAANAAVTSTTGFIAHHQQQQQQQQQLQLQQQTKVEIHAPPADMTNRQLPVPYTKP
GVNGGTAIPLPATVMVTRRCPPDKVRPLPPTPNQQTGNPYATQTVGSNHINNNNNSSSNS
NHNNNVTLIPNGNVTNIPNPTQKQSMLEKLKLFNSKEKQDKTSKSTISKRTSSSSGFSSA
RSERSDSSLSLNNDGHTGKSGKDSSLGKKSDTANSSAKVKSSKLISSKSSSKDASGSKIS
TVGKLGGDKSKVASGGQPKSESKLKPASVGGTGSRKLDAKSESKTSLLLHQQQLQQQQQL
QQSQLQPPKTMVAPPSVNTGIPKPMAAVKGTSKPSPPQPVLQDTKSKDELLKLDRALAGF
GGHQNGLISPQHLPNNISNNNSDRMNVVNTISGNNNVLGSPMKMPSQQQIPSCMSDSMHS
NSTQGASIGQHSNSSETSSVAYRPSGSESGSELISNLSSPHKSSSSFLFNDVNLNNNNNS
KFNTVPSKILNTAPNQNGTIYEQEEKQITVVPMRPLLRGYNSHVTLPTRGARGHHYISEY
CEDLGGQGYCSDGDALRKIPARYSDSMENGYLSEGGGGGGNGALMTRQQYISSLRNRTPL
PTTIEERCRSSRGDNLDSIGTSSAMDAVNGKISRQQNGSAPGPGGREYWGRMPEPPSSNG
QPPSSNHSQQGSQPPSPTSSRKDRSSPGHSRKSSSSSKIVSSRSKGTPQGFGYVKKTNGV
VDQQGQSLLTGGRTAHVSAVPRSGKLKVSGGTQTTTADFQAKAQQHPQYRSFSLTGPGAA
QLSQSVKERFGSGTHSLPKPGLDMHVFQHRMSSRGSTKLNDGSLSDTQTYAEVKPDYGSY
AMWLRHSNTASSRLSEGESLETFSIGSGGGASSGGGAASNSSGGGAGSGIPGATRPSKLL
HHARGETQPAMHHAGTTHSPRLNRSNSIRSTKSEKMYPSMLSRGPDVEIEPYYCLPVGTV
TGGSNGMVPWSQPTSPTPPARGFGGLLSPTHTNASHRLTYPKKNDEVHGSQASLLSGGSS
LYGSTEERQATEVRRLKRELIDARDQVMSLSSQLSTNFEVVVCFVIRGM
Download sequence
Identical sequences Q0IFQ0
AAEL004491-PA 7159.AAEL004491-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]