SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAEL005530-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL005530-PA
Domain Number 1 Region: 98-396
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 5.28e-35
Family NodB-like polysaccharide deacetylase 0.034
Further Details:      
 
Domain Number 2 Region: 28-86
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000248
Family Tachycitin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL005530-PA   Gene: AAEL005530   Transcript: AAEL005530-RA
Sequence length 492
Comment pep:novel supercontig:AaegL1:supercont1.161:183514:265045:1 gene:AAEL005530 transcript:AAEL005530-RA
Sequence
MRIPAAVVLFSVVALVAAQNKEEKEFKCPEGFGNGNFADPSTCRRFYQCVDGFPYINRCP
SGLFFDDVQKFCTFKNEAKCGPLANQPTATTEAPVDLAKKCNPAECDLPYCFCNKDGTQI
PKGLNADEIPQIILLTFDGAVNLNNYEHYKKVFNGKRQNPNGCDIKGTFFISHEYSNYQQ
IQTLANAGHEIAVETISLQMGLQDKGYEEWVGEMIGMRSILKHFSNVSTNEINGMRAPFL
KPGRNTQYKVIEDFGFIYDSSISVPPSPIPLWPYTLDYKIPHQCKSGTCPTKSFPGIWEV
PLNAHYVESYEGGHCPYMDQCVLHNHDADDVFAWLQEDFERYYYQNKAPYMMPFHTNWFQ
IRELERGLHKFLDWTQTLPDVWFVTVTQALTWITDPKTLNQLNNYEPWNCKSRTTQTPKP
CNISNKCALAFKEPTSNISDTRYMETCFDCPAVYPWLGDSHGTGIPGRDNYIDQSGAGVG
GDEKDAGDDDEN
Download sequence
Identical sequences Q179T5
7159.AAEL005530-PA XP_001651034.1.48696 AAEL005530-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]