SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAEL006109-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL006109-PA
Domain Number 1 Region: 75-219
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.88e-16
Family Insect pheromone/odorant-binding proteins 0.0032
Further Details:      
 
Weak hits

Sequence:  AAEL006109-PA
Domain Number - Region: 16-80
Classification Level Classification E-value
Superfamily MM3350-like 0.0196
Family MM3350-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL006109-PA   Gene: AAEL006109   Transcript: AAEL006109-RA
Sequence length 242
Comment pep:novel supercontig:AaegL1:supercont1.189:217057:217969:-1 gene:AAEL006109 transcript:AAEL006109-RA
Sequence
MLKLVLCLSALGLVACYDFKDSFYNELVLEEILDSEDAPSLMDRFKRSNPEMMDDKCKRN
HRHKCCNDANGENMDKFRETKKQCFNEVRSKDRSARGMMNPVDMFDCEKMNKTKQEYICA
VECVGRKFDIIDKDGNLLTTDKLVKFTKDNFAADPWQETVVDGLVESCLKEVAEKNEKMK
SSGEHTTCNPSSSNFGYCMWRQMTLACPKDKQDTSKKCERMREKFANNESFSMYHKHDFD
DK
Download sequence
Identical sequences Q177L7
7159.AAEL006109-PA XP_001657429.1.48696 AAEL006109-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]