SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAEL007882-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL007882-PA
Domain Number 1 Region: 140-216
Classification Level Classification E-value
Superfamily HMG-box 2.36e-17
Family HMG-box 0.00071
Further Details:      
 
Domain Number 2 Region: 293-379
Classification Level Classification E-value
Superfamily HMG-box 0.0000451
Family HMG-box 0.0048
Further Details:      
 
Weak hits

Sequence:  AAEL007882-PA
Domain Number - Region: 221-271
Classification Level Classification E-value
Superfamily HMG-box 0.00144
Family HMG-box 0.0045
Further Details:      
 
Domain Number - Region: 549-625
Classification Level Classification E-value
Superfamily HMG-box 0.0718
Family HMG-box 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL007882-PA   Gene: AAEL007882   Transcript: AAEL007882-RA
Sequence length 661
Comment pep:novel supercontig:AaegL1:supercont1.287:525941:539542:1 gene:AAEL007882 transcript:AAEL007882-RA
Sequence
MRKRSMSVFVARENNRLSKKFEGVASDNEAPSDSENEELATEIHLEETKAEIDDDLSDDW
SRHEYEVLVAQLKGTLPKKDLRKWKTSLEAVDWSSIKVGKRPTEEVERVAKEVIGKVRRF
RVLSEMLEEVPDVVSKKLCATRPKPPLTAYSLFVKEKLPQLREEHKDLKVQQIFKLIPEQ
YKALSAKKRRRYESDAAKKKEEYHVQLAKFYEEHPDLSPKKGYKPKKEPLKTPFHLFYQE
RREISSNISFQQARKEWEELPVKDKVVFIQRSFEVQGNTDLKLVNKKEMEWLGQSLGKPE
FCGRNSYEYYRRKMKAHSGKEHEAKIREGYKNLTEQEQEALKEEYQVARAKFVNQYREYI
KKLPKEKQQAEIDFLLTISEKKTAAAKKVKSEKANAAMDEDHYLDSPEEPPAAESTTIKK
KVPAKMSTKVAAIKKEHKSDNSDADSVDHAPPSTKKPTRTATAPSTPVASVASPSKRKQT
LSVTKTEPHPSASSSDEDEEEVRSPAKRPAASPVKNGKKRTSSEDQSPAVATKKTKVKKE
PEQQATKSTPKEPEKPPRDPEEFYRQRIYKGKVGKHKESYANLSSAKKREIVEQLKAAQK
QYIVDFELFLKSLPKEEIRKYIQQRAKEQQKVEKTEDSDDDDDDEDDEEDGSSSGDEDDD
E
Download sequence
Identical sequences Q170L1
AAEL007882-PA 7159.AAEL007882-PA XP_001652959.1.48696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]