SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAEL008685-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL008685-PA
Domain Number 1 Region: 199-279
Classification Level Classification E-value
Superfamily Homeodomain-like 9.41e-22
Family Homeodomain 0.0023
Further Details:      
 
Domain Number 2 Region: 42-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000776
Family LIM domain 0.019
Further Details:      
 
Domain Number 3 Region: 12-41
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000117
Family LIM domain 0.015
Further Details:      
 
Weak hits

Sequence:  AAEL008685-PA
Domain Number - Region: 106-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0613
Family LIM domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL008685-PA   Gene: AAEL008685   Transcript: AAEL008685-RA
Sequence length 345
Comment pep:novel supercontig:AaegL1:supercont1.342:237926:314941:-1 gene:AAEL008685 transcript:AAEL008685-RA
Sequence
MLKDLIAAETVTPEKCAGCGISIRDRYYLLVADRAWHNQCLRCCKCLANLETELSCYARE
GNIYCKDDYYRHFSSRRCARCGSGISASELVMRAKDLIFHVNCFSCTICGQLLRGGDTAG
IRDGRIFCGEHYDTDVLSINMTPDYGSCPDVNPYRHLFRKVLLGGNPMARFGANKVVHRL
GTIRKTRIPLAMTAGPSSLDLSSYDGSQSPGSGGTLTPNCRTKRMRTSFKHHQLRTMKSY
FAINQNPDAKDLKQLAQKTGLSKRVLQVWFQNARAKWRRNVMRQDGGLVNPGQPLGGLPS
ITTVSLHHHHHLTSANPSNNNSSDGDLSSSQALEEMHNMTFAELY
Download sequence
Identical sequences Q16Y23
7159.AAEL008685-PA AAEL008685-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]