SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAEL010153-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL010153-PA
Domain Number 1 Region: 118-207
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000263
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 272-362
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000143
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL010153-PA   Gene: AAEL010153   Transcript: AAEL010153-RA
Sequence length 765
Comment pep:novel supercontig:AaegL1:supercont1.457:605889:657074:1 gene:AAEL010153 transcript:AAEL010153-RA
Sequence
MMAASCPPFNKHIFIGGGPPSETTGSEISSVESDWGDLRLIAAQLGVANPDDLHVERFKV
DRQKLEEMIKVEAYSEGMNSAEVFFTDIMKDTTTYVSWPCRLKIGAKTKKDPHIRIVGKM
ADVLKAKDKVMARLDSRGSRVIMKMDVSYTDHSFIIGRGGNNIKRIMEETATHIHFPDSN
RSNPTEKSNQVSLCGSMEGVERARALVRISTPLLISFELPILAPGKAPPDNETPFVKEVE
KEFNVQVIFSTRPKLHSSLVLVKGSEKEELKVKEATRRLMDFMCENIANQIPVQMQLEIS
TQHHPIVLGRASGNLREIMSRTGTQIMFPDANDVNIKPIKRSQVTITGTINGVYLARQQL
IGNLPIALIFDYPENTVDSEEIAKLMYSHDVFISVRQKSRQSTLCIVIKGIEKFISNIYE
ARHQLLKCTGSKVVAEIPRSYLGPNEQAQNSQNVSQLLAGPTPQPFSPLSPINPMPFATN
AWPSPTPPQEFALNQMRNQFQNLQMGTSKMHHPLAMPPGLGKSQLHAMNTSLRQTHLQVP
GAQQQHRLQLGGRSSDAGMSCQNTSNSSAGGDHSSGYHSLNCSNSSLDQQLQSIPSSSGS
ASTSLINSSPDTSGISSVAALNRCRHLSYSDSPQYQTDLSDQRTPMAYEQKSTLNDTFVF
NFDPRVVAGYKAMHLSPQQGEIRTPTPAWQGLGLSQTSPAPLEACDLSWVNNSGSSSSSG
NDSRLNMTTTMIEVTPMRQREQLSQYNDVTSILTSLGLEHYISES
Download sequence
Identical sequences Q16TR2
AAEL010153-PA 7159.AAEL010153-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]