SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAEL013012-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL013012-PA
Domain Number 1 Region: 536-731
Classification Level Classification E-value
Superfamily Sec7 domain 2.62e-75
Family Sec7 domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 51-124,205-224,306-489,936-1372
Classification Level Classification E-value
Superfamily ARM repeat 4.76e-25
Family Armadillo repeat 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL013012-PA   Gene: AAEL013012   Transcript: AAEL013012-RA
Sequence length 1630
Comment pep:novel supercontig:AaegL1:supercont1.775:40660:59383:1 gene:AAEL013012 transcript:AAEL013012-RA
Sequence
SSAEDIKEELKEAGQTEPNGEVPVPSAALPLPKNDSANIINAEKYFLPFELACQSKTPRI
VVTALDCLQKLIAYGHLTGNIPDSSNPGKFLIDRIVTTICNCFMGPQTDEGVQLQIIKAL
LTVVTSQYVEVHEGTVLQGVRTCYDIYLSSKNLINQTTARATLTQMLNVIFTRMENQAYE
MGPSGMSAIGSPTTGQDESPNVVEEKHPDYDMVRGIVDEIVDNVMVAVAAAAEENSKANS
TVSNNGTDNTSIARVPSQESMEVTSENDSIVTAKFTHILQKDAFLVFRALCKLSMKPLPE
GHPDPKSHELRSKILSLHLLLSILQNAGPVFRSNEMFIMAIKQYLCVALSKNGGSSVPEV
FELSLSIFVALLSNFKIHLKKQIEVFFKEIFLNILEANSSSFEHKWMVIQALTRICADAQ
SVVDIYVNYDCDFSAANLFERLVNDLSKIAQGRQALELGTSVNQEKSMRIRGLECLVSIL
KCMVEWSKDLYVNPNSQTTPDENHEPMKSHGGSTVSINSVGSTNTSGGNREVLDLPYELE
ERKQRKEVMEMGIDMFNRKPKKGIQFLQERGLLGTSNEDVAKWLHEDERLDKTQVGDYLG
ENDDQSKAVMCAYIDAMNFAELDIVAALRYFLEGFRLPGEAQKIDRLMEKFASRYCDCNP
NNTLFASADTVYVLAFSVIMLTTDLHSPQVKHKMTKEQYIKMNRGISDNKDLPEEYLSQI
YDEIAGHEIKMKNTVSSKPGKQIIVNEKKRKLLWNVEMEALSTTAKNLMESVSHVKAPFT
SAKHLEHVRPMFKMAWTSFLAAFSVGLQDCDDPEIASLCLDGIRCAVRIACIFQMTLERD
AYVQALARFTLLTANSPINEMKAKNIDTIKTLIMVAHTDGNYLGTSWLDIVKCISHLELA
QLIGTGVRPEFLSGPASHRDALDPTAKEHIGETSSQSIVVAVDRIFTGSIRLDGDAIVDF
VKALCQVSLDELTRPQPRMFSLQKIVEISYYNMGRIRLQWSRIWQILGEHFNAVGCNINE
EIAFFALDSLRQLSMKFIEKGEFTNFRFQKDFLRPFEHIMKKNNSPAIRDMVVRCVAQMV
NSQAHNIKSGWKNIFSVFHLAAGDHDGSIVELAFLTTGKIITDLYQSQFPIMIDSFQDAV
KCLSEFACNAKFPDTSMEAIRLVRTCALCVNDAPNLFAEHAGMENDVSVPEEDRVWVRGW
FPMLFSLSCVVNRCKLDVRTRGLTVLFEIVKTHGDAYKPNWWRDLFNILFRIFDNMKLPE
HYSEKAEWMTTTCNHALYAIVDVFTQYFDVLGPMLLKDLYCQLHWCVQQNNEQLARSGTN
CLENLVISNGLKFNEDTWDKTCQCMLDIFNSTLPNELLTWKPDPHPQIINHASHYPQNGD
IPRHGILKRTPSQHSCVVQLELIQTIDNIIFFPATSRKEDAETLAQAAAELIGSTTGSIL
NHSLSTEECQREEQGMYSYLNTPHLLQLIDCLMQSHRFAKKFNSNHEQRNVLWKAGFKGS
LKPNLLKQETQSLACVLRILFKMYSDESRRRDWQDIEQRLIAVCTEALDYFLSLQSEPHR
DAWTSLLLLVMTRLLKMPDSRFAAHISSYYVLMCDLMCFDLKPELRTVLRRVFLRISPVF
GISSTANSAT
Download sequence
Identical sequences Q16KG1
AAEL013012-PA 7159.AAEL013012-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]