SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAEL014144-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL014144-PA
Domain Number 1 Region: 420-631
Classification Level Classification E-value
Superfamily TPR-like 5.52e-38
Family Tetratricopeptide repeat (TPR) 0.0041
Further Details:      
 
Domain Number 2 Region: 824-1036
Classification Level Classification E-value
Superfamily TPR-like 5.82e-38
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 3 Region: 235-436
Classification Level Classification E-value
Superfamily TPR-like 1.2e-35
Family Tetratricopeptide repeat (TPR) 0.0063
Further Details:      
 
Domain Number 4 Region: 29-135
Classification Level Classification E-value
Superfamily TPR-like 1.42e-32
Family Tetratricopeptide repeat (TPR) 0.00045
Further Details:      
 
Domain Number 5 Region: 642-834
Classification Level Classification E-value
Superfamily TPR-like 1.6e-31
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Domain Number 6 Region: 155-274
Classification Level Classification E-value
Superfamily TPR-like 0.000000000324
Family BTAD-like 0.097
Further Details:      
 
Domain Number 7 Region: 1003-1127
Classification Level Classification E-value
Superfamily TPR-like 0.000000414
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL014144-PA   Gene: AAEL014144   Transcript: AAEL014144-RA
Sequence length 2372
Comment pep:novel supercontig:AaegL1:supercont1.1018:191275:199230:1 gene:AAEL014144 transcript:AAEL014144-RA
Sequence
FPLFFQNEPEGTPELPAANRALFLEKVRQSNTACQNGDFTTAVQLYTDALALDPSNHILF
SNRSAARLKQGQFALALQDATRARELCPQWPKAYFRQGVALQCLGRYGEALAAFSSGLAQ
DPNSKQLLAGLVEASIKSPLRHALEPTFQQLKAMKLDQSPFVVISVVGQELLGAGQYHSA
VTVLESALRIGSCSLKLRGSVFSALSSAHWALNHQGSYKEALTSHRYQLVLAMKCKDTQA
AAAALTSLGHVYTAIGDYPNALASHKQCVQLVKQMGDRLQEAREIGNVGAVYLAMGEFDS
AVDCHTQHLRLARKLGNQVEEARAYSNLGSSYHYKRNFTQAITYHENVLRIAQQLGDRAI
EARAYAGLGHAARCGHDFHQAKRWHEKQLEMALAARDKVGEGRACSNLGIVYQLLGEHDA
ALKLHQAHLTIARQLQDKAGMGRAYGNIGNAYSAAGFYEQAIKYHKQELIISKEVHDRSA
EASTHGNLAVAYQALGAHDMALMHYRAHLNIARELKDTAGEACALLNLGNCLSSRQEFAQ
AVPYYEQYLMLSQELGDVAAEGKACHFLGYAHYCIGNYREAVRYYDQDLALAKDLQNKMN
MGRAYCNLGLAHLALGNTAGALECQKYFLAIAHMTNHLPGKFRALGNIGDVLIRMGDVDE
AIKMYQRQLSLARQARERGMEAAACGALGLAHRLLKKFDKALGYHTQELTLRQEMGDLPG
ECRAHGHLGAVHMALGNYTHAVKCYQEQLERAQELQDSAVEAQAFGNLGIARLNMGHYED
AIGYLEQQLGTLEQVNTPTAQHDRARALGHLGDCYDALGDYHAEAIKCHDRHLALAIALQ
SPRDQERAYRGLGNCYKSVGNLQEALVCLEKRLVVSHELGNPEAKAAAYGDLGSIHSALG
NYEQAINCLEHQRDIARELGDRALTSDAISGLGAVFHQMGDYEGSLRLHKQDLELCENMG
HAALQARSCGNLGSVYESLKNYAESVRHFEKQLSLTTDRLTKAHACLSLGRVYHTMEQVS
QAVSFLRQGLAIVQSLNKLEDEAKIRYRLGLSLLASGDEDNSRQQMESAAQILESIRSDQ
VTPEARTTLYDLQTSCYQTLQRVLVNMGRNEEALVAAERCRSRMGADSNQSAENSLNNRK
TLLTCSEYIFDTVNKSKTNIIYYSLAGSELYAWFLSPQKRIVRFHVAKIDEQTLQMKKKP
SGGENGNACESLLDQYINFVRDSLGVNSGSVLQEGDGSGWKSSNENLIDDFANERAGFLR
MVNRNHLLNSSNYSLSSLFSLGSVGGSVASLQGSTSLQGSTRSRRSNMLPPWQGPSCLHV
LYNLLLAPFEDLLPDISTTSRIGRRELILVLEKELYLVPFAILRSGDESGEYLSERCSLL
TVPSLHTLRQKSRTKTREPGLNSALVVGGPKIPSSLSETWGWSESPASLQEAAMVSDMLN
TKPLVSCSATKETIVSELTSAECVHFAANVSWKLGAVILSPGEIENDEDNADLSSTNMEI
PPLSDFILSAADLLAMKLSAKLVVLSSYHSVEPITGTGVANLAGSWLFAGTGAVLVSLWP
VPETAAKILLRAFYSALLQGTRAAKALAEAMQTVQHTKHFAHPANWAGFILIGGNVRLSN
KVALIGQALCELMRTPDKCRDALRVCLHLVEKSLQRIHRGQKNAMYTTQKSIENKAGPVV
GWKDLLMAVGFRFEPAANGIPSSVFFPQTDPEDRLSQCSASLQALLGLSPTTLHALSKLV
NNAEIADEIIGVMRNVVTQFPSKGTIDNESIDIPLSVRLWRVSGCHELLASLGFDLMEVG
QDQVTLRTGKQANRRNCQFVLQSLLALFDTQEAPKSLGIESSSSSESLNEDISDDPQAKA
PSPTPTAPEQRSVSPAGTVKIPFLSTRSAFISYVRRRGEPDGGQTETSGQVPIGGLQAQA
HLANTTDSELSDGYTTQQILMKSDHLAKGLGYSSLRGTIKVSRPGGGGESDAAFTPSPPV
TIQNVDSNVSLALAHQTRIRNLYTNNGLGTYGHETNPNLRRPDSSSSASSATDWEGSGHA
TVLRRANQGHHNLPPLPPPRQTLPMSMRSRKLKMQPMQQPPTHGTSTITRSKMVDQFAFM
DRLSCRTEISSSTLGNHGAPPRKPLSTLPDDERTLNLNASKLYFNPTEAEIIPLTETPAD
LGLNKAPTTSMSSSNIQDSILRHMSREMTPTISEVYHERNIGLGLAPSLSKLLLSKNYED
SPDIKSSTAASMLNKPSALTVGNLAEAMNEIEMNATTSTKLEEGQCTICNSPSDLLCGCS
TTSTVAAVAAMTAALGANTITKKSNSKPWLSNVTPNIVKPGDLTTADILEQQKQLKSTVS
GLTSGSPFSDLSRRDEGDGRSVADSQCSGSFR
Download sequence
Identical sequences Q16H64
7159.AAEL014144-PA AAEL014144-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]