SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|85057789|ref|YP_456705.1| from Aster yellows witches'-broom phytoplasma AYWB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85057789|ref|YP_456705.1|
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.64e-27
Family Ribosomal protein S14 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85057789|ref|YP_456705.1|
Sequence length 89
Comment 30S ribosomal protein S14 [Aster yellows witches'-broom phytoplasma AYWB]
Sequence
MAKKSKIVKDQKQRELVLKYSKLRLELKKKADYAGLSQIPAKASPVRLKNRDSIDGRPRG
YIRKFGISRINFRQLAHQGKLPGVRKTSW
Download sequence
Identical sequences Q2NIW7
gi|85057789|ref|YP_456705.1| WP_011412788.1.27578 322098.AYWB_509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]