SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56475901|ref|YP_157490.1| from Aromatoleum aromaticum EbN1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56475901|ref|YP_157490.1|
Domain Number 1 Region: 122-527
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.27e-78
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00031
Further Details:      
 
Domain Number 2 Region: 21-114
Classification Level Classification E-value
Superfamily Cytochrome c 0.00000000000000774
Family monodomain cytochrome c 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56475901|ref|YP_157490.1|
Sequence length 534
Comment cytochrome C [Aromatoleum aromaticum EbN1]
Sequence
MNFLRSKAATFRPSTRLFAVPVLLAAVFVAFSSSVRADDSDMASRHYQQYCASCHGGNRL
GASGPALLPENLARLRKEEALEVIRDGRVATQMPAFDATLKADEIAALGALIYTPVVPAP
KWSEADIRASRIQHVDPATLAAKPVFDADPMNLFVVVEGGDHHVSVLDGDKLEPIHRFAS
RLALHGGPKFTKDGRFVFFGSRDGWVTKYDLWNLKVVAEVRAGINTRNVAVSPDGRHVAV
ANYLPHTLVLLDGDLNLLKSIDVTDREGKRSSRVSAVYEATPRNAFVAALKDVPEVWEIS
YDPTAEEIPIGYVHDYKLREGAFVRGYLNPRRTELTQVLDDFFFTQDYSMVLGASREGVG
QVVNLDVRRKIADLPLDGMPHLGSGITWEWQGRRVMASTNLKAAEVTVIDLEDWSVIKRI
RTRGAGFFLRSHENSRYAFVDSMMSRDAKNILQVIDKQTLEIVRELKAPPGQTLAHVEFT
RDGRYALASLWEMDGALIVYDAQTLEEVKRIPMKKPVGKYNVWNKTMREEGTSH
Download sequence
Identical sequences Q5P7X2
gi|56475901|ref|YP_157490.1| 76114.ebA876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]