SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56475910|ref|YP_157499.1| from Aromatoleum aromaticum EbN1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56475910|ref|YP_157499.1|
Domain Number 1 Region: 152-578
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 2.88e-125
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000000536
Further Details:      
 
Domain Number 2 Region: 49-168
Classification Level Classification E-value
Superfamily Cytochrome c 8.17e-22
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.0000827
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56475910|ref|YP_157499.1|
Sequence length 578
Comment cytochrome cd1 nitrite reductase [Aromatoleum aromaticum EbN1]
Sequence
MSSKRRSWTTGAFLLASLPMAMSQAYAQANTEEHVGEAEAKYQAGGSPLADVEMYQDINP
DAPKMTKVEFDKARNIYFQRCAGCHGVLRKGATGKPLTPDITLPKGSEYLKVFIKYGSPA
GMPNWGTSGELSDDDVDLMARYIQQSPPQPPEFGMAQMKETWKVIVPPEQRPNKKMNDYN
ISNIFSTTLRDTGEIALIDGDTKKIINIVKTGYAVHISRISASGRYLFVIGRDAKINMID
LWMEKPDNVAEIRIGLEARSVDTSKYKGYEDKYAIAGAYWPPQFVIMNGDTLEPQKIVST
RGLTVDTQEYHPEPRVAAIVASHFKPEFVVNVKETGKTLMVDYSDIQNLKTTEIGSAPYL
HDGGWDASKRYFMVAANQSNKVAAIDAKDGKLAGLVDVGKIPHPGRGANFTHPKYGPVWA
TGHLGDDTIALIGTDPVKHKQYAWKMVDTLKSQGGGSLFIKTHPKSKHLYVDNPLHPEAK
VSQTVAVYDLSNLQAGSKVLPIAEWAGLKDDGAKRVVQPEYNKDGNEVWFSVWSAKDKES
AIVVVDDKTLELKTVIKDPKLITPTGHFNIYNTQHDVY
Download sequence
Identical sequences Q5P7W3
76114.ebA888 gi|56475910|ref|YP_157499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]