SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|49184356|ref|YP_027608.1| from Bacillus anthracis str. Sterne

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49184356|ref|YP_027608.1|
Domain Number 1 Region: 240-415
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 9.42e-45
Family Peptidoglycan hydrolase LytM 0.0014
Further Details:      
 
Domain Number 2 Region: 24-126
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000662
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|49184356|ref|YP_027608.1|
Sequence length 417
Comment M24/M37 family peptidase [Bacillus anthracis str. Sterne]
Sequence
MKKKFAAFSVLAAGTIFVSPLLSPAYAETNQDKLSNIQSELEGKQNDLQNKSAEKEQIEK
EIQELQKKIDDLTTSINKNEAELNDTKKEISKTQQVIAEKKKHIEQLQTNIDTRQEVIKQ
RLQSMQEKPRTNIITEVLTTSTNIADLVDNMYSVSLILNNDTDIVKKQTTDQNAVTKEKE
AVEKKEQELKEAEQKLVHKQQELQTNQQQQQTFISDLHTKVAKVDSEIEGLEESKGILEN
QRQAVQKAIEEEKRAEEARKAEEARKQATTSAQKAQAAPTPHDTNIGGFIKPAAGSKTSG
FGVRSIDNHKGIDIAASGTVPIIAAADGVVIRSELSSSYGNVVYLSHRINGKTYTTVYAH
MSSRSVSNGQTVKQGTQLGFMGNTGQSYGQHLHFELHLGEWNVGKTNAVDPSPYIGL
Download sequence
Identical sequences Q81T40
IDP02216 gi|386735236|ref|YP_006208417.1| gi|227815722|ref|YP_002815731.1| NP_843905.1.87267 WP_000726094.1.100214 WP_000726094.1.100595 WP_000726094.1.10208 WP_000726094.1.13115 WP_000726094.1.13820 WP_000726094.1.14721 WP_000726094.1.14855 WP_000726094.1.15460 WP_000726094.1.15569 WP_000726094.1.16170 WP_000726094.1.16997 WP_000726094.1.17146 WP_000726094.1.18976 WP_000726094.1.19258 WP_000726094.1.19435 WP_000726094.1.20390 WP_000726094.1.20680 WP_000726094.1.21021 WP_000726094.1.21258 WP_000726094.1.21776 WP_000726094.1.22865 WP_000726094.1.2419 WP_000726094.1.24334 WP_000726094.1.24556 WP_000726094.1.24608 WP_000726094.1.25716 WP_000726094.1.25752 WP_000726094.1.2618 WP_000726094.1.26665 WP_000726094.1.26721 WP_000726094.1.27644 WP_000726094.1.27987 WP_000726094.1.28427 WP_000726094.1.28729 WP_000726094.1.29101 WP_000726094.1.29787 WP_000726094.1.30110 WP_000726094.1.3236 WP_000726094.1.32576 WP_000726094.1.33338 WP_000726094.1.33367 WP_000726094.1.33740 WP_000726094.1.33876 WP_000726094.1.34646 WP_000726094.1.35684 WP_000726094.1.35886 WP_000726094.1.36305 WP_000726094.1.36763 WP_000726094.1.38036 WP_000726094.1.39781 WP_000726094.1.41165 WP_000726094.1.41675 WP_000726094.1.4439 WP_000726094.1.45305 WP_000726094.1.45533 WP_000726094.1.46236 WP_000726094.1.46699 WP_000726094.1.47145 WP_000726094.1.4763 WP_000726094.1.47798 WP_000726094.1.52794 WP_000726094.1.53137 WP_000726094.1.53493 WP_000726094.1.53683 WP_000726094.1.54117 WP_000726094.1.54189 WP_000726094.1.55811 WP_000726094.1.55958 WP_000726094.1.56042 WP_000726094.1.56176 WP_000726094.1.56270 WP_000726094.1.58160 WP_000726094.1.59095 WP_000726094.1.59310 WP_000726094.1.59575 WP_000726094.1.60402 WP_000726094.1.61213 WP_000726094.1.63560 WP_000726094.1.68607 WP_000726094.1.69203 WP_000726094.1.69822 WP_000726094.1.69894 WP_000726094.1.70065 WP_000726094.1.72704 WP_000726094.1.73325 WP_000726094.1.74226 WP_000726094.1.74538 WP_000726094.1.75499 WP_000726094.1.75870 WP_000726094.1.76125 WP_000726094.1.76783 WP_000726094.1.77668 WP_000726094.1.77824 WP_000726094.1.78644 WP_000726094.1.79315 WP_000726094.1.79584 WP_000726094.1.80695 WP_000726094.1.81799 WP_000726094.1.82289 WP_000726094.1.83951 WP_000726094.1.84045 WP_000726094.1.85689 WP_000726094.1.86119 WP_000726094.1.86140 WP_000726094.1.86288 WP_000726094.1.8698 WP_000726094.1.8825 WP_000726094.1.90791 WP_000726094.1.9186 WP_000726094.1.92686 WP_000726094.1.92831 WP_000726094.1.93271 WP_000726094.1.93927 WP_000726094.1.94237 WP_000726094.1.94322 WP_000726094.1.94784 WP_000726094.1.96934 WP_000726094.1.97781 WP_000726094.1.97861 WP_000726094.1.98216 WP_000726094.1.99445 WP_000726094.1.99485 YP_027608.1.16718 gi|49184356|ref|YP_027608.1| gi|30261528|ref|NP_843905.1| gi|229604426|ref|YP_002865941.1| 198094.BA_1449 260799.BAS1339 261594.GBAA1449 568206.BAMEG_3143 592021.BAA_1519 gi|47526724|ref|YP_018073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]