SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|107026823|ref|YP_624334.1| from Burkholderia cenocepacia AU 1054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|107026823|ref|YP_624334.1|
Domain Number 1 Region: 29-234
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.32e-47
Family Phospholipase D 0.034
Further Details:      
 
Domain Number 2 Region: 283-461
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.04e-33
Family Nuclease 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|107026823|ref|YP_624334.1|
Sequence length 516
Comment phospholipase D/transphosphatidylase [Burkholderia cenocepacia AU 1054]
Sequence
MIRLRSWGAILSLLMLAACASLPPQADRAPTHAFTDTDDTRLGVAFRQQAAAHPGQDAFH
LLTDPVDALDARVLLADRAERSLDLQYYIWHDDLTGHELADAVMRAADRGVRVRALLDDL
GTNADDRKLLEISAHPNIEIRLFNPVASRRFKKLGTLFEFSRVNRRMHNKAMIADNQAAI
VGGRNIGDEYFGASSMLEFGDLDVVVHGPVVKDISTEFDTFWNSPYAYPVDTLVGHDAAP
GGLERERERLRDYLRAMEDNPYVLEARQRLDRIVHGQGTELSWGHATVLYDDPSKIAHPP
KDRDGHLMPQLRALALQPRHDLLIVSPYFVPGKEVVERLRALTARGVRVTVLTNSLASTD
VAAVHAGYRRYRSDLVNAGVRLYERRPSGDKSISKQVIIGSSRASLHAKTYVFDHTSIFI
GSMNLDPRSLNLNTEIGVYCESPAIASQVADDLEARLDQIAWRVEARTDPAGSGRLKWVQ
TDADGKVTEIDHEPEVSAPRRMEVWFLGLFPIESQL
Download sequence
Identical sequences A0A0H2XXH3 A0A1U9MXF5 B1K3S1
331271.Bcen_4479 406425.Bcenmc03_3640 WP_011548144.1.27194 WP_011548144.1.43430 WP_011548144.1.5376 WP_011548144.1.90614 WP_011548144.1.96618 gi|107026823|ref|YP_624334.1| gi|170736022|ref|YP_001777282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]