SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for BC1T_05002 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_05002
Domain Number 1 Region: 239-337
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.28e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 418-478
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000862
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Weak hits

Sequence:  BC1T_05002
Domain Number - Region: 326-411
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BC1T_05002
Sequence length 664
Comment | BC1G_05002 | Botrytis cinerea conserved hypothetical protein (665 aa)
Sequence
MSAVDTAVPNGHSEANGNGPELTRAQKLMQQHDHEHQPSIEEVPDEEDLKHGEQPTSTSV
LEDVNGDSTAPGWVPTVSTKAAGKQKEDARKEPSIDTQSHELFPALGATSQPKPQVQGIW
GGGKSPANANGTPTNGVSRASTPISGAATPLSTVNRPKVNQPGQQHQERIELAKDHILKR
DQLKKPLPEILREVNKKYRSNITQTTGLEGKMTFTAYGPPAASRTGIKALMEQIGAKQEI
HVTIPSKARAFIIGKQGSKIKELQEATGARIQMPKDNKPSPVDDDEDATVDVTVVGNAVA
VAEAKKAIEKIVGEKAGTTKTKLRGIPSEFYRFIAGPYDTHADSLRNTHNLSELEIPSNY
ILRTVPQAHDGPIFVPAAADNCITLNGDRAAVLAARAEIERRAKQLHEELTRHEVRGISK
GRHQSIIGEKGNPGEDFFATTGCALFVPEKDEQDNTFTIVGPADKIQNAVREARKLSTKS
QSATIDVEQHFTGIPNSKEHGHNLSRYLRQRNEMERLERLHNARIYTPNSVNSSIWEIFS
GETEAVYDVQGQLMNIMDAHPHSRMANIPVDPFYHKHLEQDISPRVKKDYGVHVVLPDGP
NGDVLLVFEGPTGNEPDYSISRGQPSRNDIAQFKRGLEDARKHIIDVISSQAEITSESID
VPKM
Download sequence
Identical sequences 332648.A6RXH8 BC1T_05002 XP_001556384.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]